Glyma17g04290 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g04290

Feature Type:	gene_model
Chromosome:	Gm17
Start:	2862782
stop:	2864492
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g04290

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G17350	AT	Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: endomembrane system; EXPRESSED IN: 19 plant structures; EXPRESSED DURING: 13 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G50290.1); Has 203 Blast hits to 203 proteins in 13 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 203; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). \| chr3:5934111-5935276 FORWARD LENGTH=301	SoyBase	E_val: 3.00E-115	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
UniRef100_I1MRW3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MRW3_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_Q9LUT6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Gb\|AAD32889.1 n=1 Tax=Arabidopsis thaliana RepID=Q9LUT6_ARATH	SoyBase	E_val: 2.00E-111	ISS

Expression Patterns of Glyma17g04290

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g04290

Paralog	Evidence	Comments
Glyma07g36130	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g04290 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g038600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g04290

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g04290

Limit To All Plant Sequences

>Glyma17g04290.1   sequence type=CDS   gene model=Glyma17g04290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAAATGCAGCTTTTATCATCACCATTCACCATCTTCAAACTCCTCATACTTACATTATTATTACAAGTCATTCCCACTCTGACACTCTCCCCTTGCAAAACCACATGTGGCAGCATTCCCATAAACTACCCCTTTGGCCTAGAAGATGGATGTGGTGCACCCCAGTTCAGACACATGCTGAACTGCAGCACCGACTTGTTCTTTCAAACCCCTTCAGGTTCTTACAAGGTTCAATCCATAGACTACGACAAAAAAACCATGGTAATCTATGACCCCTCCATGTCCACTTGCTCCATTCTCCAACCTCACCACGACTTCCAAATGACCGATGTTCAATCCGCAATAATCCCCCCATCACAGGACACAGTTTTCGTGCTTCTAAACTGCTCCATAGACTCTCCCGTTCTCAACCACTACAAGTACCTCTGTTTCAACTTCGCCGGTCACACGTGCGACGAGCTTTACGGTTCGTGCAACGCCTTCAGGGTCTTTCATTTGCTGACAAATAGTTCTCCACCGTGTTGTTTCACAAGTTATAGCACCGTGAAGTTCATGAGCATGAACATATTGGACTGCACGCACTATACGAGTATGTTTAACACGGATAATTTGAAGGGTGTTGGCCCTTTGGACTGGGTTTATGGGATCAAGCTTTCTTTCAGTGTGCCTGATACTGGATGTGAAAGTTGCAGAAAATCTGGTGGGACCTGTGGGTTTGATACTGATACAGAAGGTTTGCTATGTCTTTGCTCAAGTTTCGCTAATTCAACAAGGGAATGTGCTGCTGGAAGCATAATATCAAAAGGACAGAACAATGCTCCTTGGACACACTACCTACTGGTTTTGCTTTTTGTAGCTTATTTTTTCTCACTAGGTTAA

Predicted protein sequences of Glyma17g04290

Limit To All Plant Sequences

>Glyma17g04290.1   sequence type=predicted peptide   gene model=Glyma17g04290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQMQLLSSPFTIFKLLILTLLLQVIPTLTLSPCKTTCGSIPINYPFGLEDGCGAPQFRHMLNCSTDLFFQTPSGSYKVQSIDYDKKTMVIYDPSMSTCSILQPHHDFQMTDVQSAIIPPSQDTVFVLLNCSIDSPVLNHYKYLCFNFAGHTCDELYGSCNAFRVFHLLTNSSPPCCFTSYSTVKFMSMNILDCTHYTSMFNTDNLKGVGPLDWVYGIKLSFSVPDTGCESCRKSGGTCGFDTDTEGLLCLCSSFANSTRECAAGSIISKGQNNAPWTHYLLVLLFVAYFFSLG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain