Glyma17g04210 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g04210

Feature Type:	gene_model
Chromosome:	Gm17
Start:	2809510
stop:	2812815
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g04210

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G17240	AT	Annotation by Michelle Graham. TAIR10: lipoamide dehydrogenase 2 \| chr3:5890278-5892166 REVERSE LENGTH=507	SoyBase	E_val: 0	ISS
GO:0006096	GO-bp	Annotation by Michelle Graham. GO Biological Process: glycolysis	SoyBase	N/A	ISS
GO:0006486	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein glycosylation	SoyBase	N/A	ISS
GO:0009060	GO-bp	Annotation by Michelle Graham. GO Biological Process: aerobic respiration	SoyBase	N/A	ISS
GO:0009627	GO-bp	Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance	SoyBase	N/A	ISS
GO:0009744	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus	SoyBase	N/A	ISS
GO:0009749	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to glucose stimulus	SoyBase	N/A	ISS
GO:0009750	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus	SoyBase	N/A	ISS
GO:0034976	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress	SoyBase	N/A	ISS
GO:0045454	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005747	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial respiratory chain complex I	SoyBase	N/A	ISS
GO:0005759	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial matrix	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0048046	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: apoplast	SoyBase	N/A	ISS
GO:0004148	GO-mf	Annotation by Michelle Graham. GO Molecular Function: dihydrolipoyl dehydrogenase activity	SoyBase	N/A	ISS
GO:0005507	GO-mf	Annotation by Michelle Graham. GO Molecular Function: copper ion binding	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
GO:0009055	GO-mf	Annotation by Michelle Graham. GO Molecular Function: electron carrier activity	SoyBase	N/A	ISS
GO:0016491	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity	SoyBase	N/A	ISS
GO:0016668	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on a sulfur group of donors, NAD(P) as acceptor	SoyBase	N/A	ISS
GO:0050660	GO-mf	Annotation by Michelle Graham. GO Molecular Function: flavin adenine dinucleotide binding	SoyBase	N/A	ISS
GO:0050897	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cobalt ion binding	SoyBase	N/A	ISS
KOG1335	KOG	Dihydrolipoamide dehydrogenase	JGI		ISS
PTHR22912	Panther	DISULFIDE OXIDOREDUCTASE	JGI		ISS
PTHR22912:SF20	Panther	DIHYDROLIPOAMIDE DEHYDROGENASE	JGI		ISS
PF00070	PFAM	Pyridine nucleotide-disulphide oxidoreductase	JGI		ISS
PF02852	PFAM	Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain	JGI		ISS
PF07992	PFAM	Pyridine nucleotide-disulphide oxidoreductase	JGI		ISS
UniRef100_I1MRV6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Dihydrolipoyl dehydrogenase n=1 Tax=Glycine max RepID=I1MRV6_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_I1MRV6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Dihydrolipoyl dehydrogenase n=1 Tax=Glycine max RepID=I1MRV6_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma17g04210

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g04210

Paralog	Evidence	Comments
Glyma07g36040	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g04210 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g037900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g04210

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g04210

Limit To All Plant Sequences

>Glyma17g04210.1   sequence type=CDS   gene model=Glyma17g04210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGATGGCAAGCCTGGCTCGACGGAAGGGTTACGCCGTCGTTTTGTCGTCGAGGTCGTCGTTTTGTCTGACAAGCTGGAGGGGATTCGCGTCCGGATCTGACGAAAACGACGTCGTCGTCATCGGCGGCGGTCCCGGCGGCTACGTGGCCGCCATCAAAGCCGCGCAGCTCGGTCTGAAAACCACTTGCATCGAAAAGCGTGGCACTCTCGGCGGTACCTGCCTCAACGTCGGATGCATCCCTTCCAAGGCACTTCTGCATTCTTCCCACATGTATCATGAGGCTAAACATGCATTTGCCAACCATGGGGTCAAGTTTTCATCTGTTGAGGTTGATTTGCCAGCCATGATGGCCCAAAAAGATAAAGCAGTTTCTAATCTTACCAAGGGTATTGAAGGTCTATTCAAGAAAAACAAGGTAAACTATGTCAAAGGTTATGGCAAATTTGTTTCACCATCTGAAGTCTCTGTGGACACCACTGAAGGTGGAAATACTGTTGTGAAAGGCAAGCATATTATAATTGCCACTGGCTCGGATGTGAAATCATTGCCTGGCGTCACTATTGATGAAAAGAAAGTCGTATCATCAACGGGGGCTCTTGCTTTGACTGAAATCCCCAAGAGACTCGTAGTCATTGGGGCAGGCTACATTGGGCTGGAAATGGGCTCCGTATGGGGCCGTCTTGGCACCGAGATAACAGTTGTTGAATTTGCATCGGAGATTGTTCCAACCATGGATGCAGAGGTCCGAAAGCAGTTTCAGCGTTCTCTTGAGAAGCAAGGCCTGAAATTCAAGCTGAAGACAAAGGTAGTTGGAGTTGATACTTCTGGGGATGGTGTGAAGCTAACTCTTGAACCGGCTGCTGGTGGTGATCAAACTACACTTGAAGCAGATGTTGTCCTTGTATCTGCTGGTAGGACTCCATTCACTGCTGGACTTGGATTGGACAAGATAGGTGTTGAAACTGACAAGATTGGACGGATTTTGGTAAACGAACGATTTGCCACAAATGTCTCTGGTGTTTATGCAATTGGAGATGTAATTCCAGGCCCAATGTTGGCACACAAGGCAGAAGAAGACGGTGTTGCTTGTGTTGAGTACATAGCTGGTAAGGTGGGCCATGTGGATTATGACAAAGTCCCCGGTGTTGTCTATACAATGCCCGAGGTTGCATCTGTTGGGAAGACAGAGGAGCAGGTGAAGGAACTTGGAGTTGAATACCGTGTTGGCAAGTTCCCGTTCATGGCTAATAGCAGAGCTAAGGCAATTGACAATGCTGAAGGACTGGTGAAGATATTGGCTGAAAAGGAGACAGACAAGATATTGGGAGTGCACATTATGGCACCCAATGCAGGAGAGCTTATTCATGAAGCAGCAATAGCACTACAGTATGATGCATCTAGTGAGGACATTGCACGTGTGTGCCATGCACATCCAACAATGAGCGAGGCTGTGAAAGAAGCCGCAATGGCCACTTATGACAAGCCCATTCACATTTAA

Predicted protein sequences of Glyma17g04210

Limit To All Plant Sequences

>Glyma17g04210.1   sequence type=predicted peptide   gene model=Glyma17g04210   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAMASLARRKGYAVVLSSRSSFCLTSWRGFASGSDENDVVVIGGGPGGYVAAIKAAQLGLKTTCIEKRGTLGGTCLNVGCIPSKALLHSSHMYHEAKHAFANHGVKFSSVEVDLPAMMAQKDKAVSNLTKGIEGLFKKNKVNYVKGYGKFVSPSEVSVDTTEGGNTVVKGKHIIIATGSDVKSLPGVTIDEKKVVSSTGALALTEIPKRLVVIGAGYIGLEMGSVWGRLGTEITVVEFASEIVPTMDAEVRKQFQRSLEKQGLKFKLKTKVVGVDTSGDGVKLTLEPAAGGDQTTLEADVVLVSAGRTPFTAGLGLDKIGVETDKIGRILVNERFATNVSGVYAIGDVIPGPMLAHKAEEDGVACVEYIAGKVGHVDYDKVPGVVYTMPEVASVGKTEEQVKELGVEYRVGKFPFMANSRAKAIDNAEGLVKILAEKETDKILGVHIMAPNAGELIHEAAIALQYDASSEDIARVCHAHPTMSEAVKEAAMATYDKPIHI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain