SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g04190

Feature Type:gene_model
Chromosome:Gm17
Start:2800892
stop:2804582
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g04190
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G30510AT Annotation by Michelle Graham. TAIR10: ribosomal protein S1 | chr5:11619262-11621223 REVERSE LENGTH=416 SoyBaseE_val: 0ISS
GO:0006098GO-bp Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt SoyBaseN/AISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0009773GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem I SoyBaseN/AISS
GO:0009902GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast relocation SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0015995GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0034660GO-bp Annotation by Michelle Graham. GO Biological Process: ncRNA metabolic process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
PTHR10724Panther TEX PROTEIN-RELATEDTRANSCRIPTION ACCESSORY PROTEIN (S1 RNA BINDING DOMAIN) JGI ISS
PF00575PFAM S1 RNA binding domain JGI ISS
UniRef100_C6T883UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T883_SOYBN SoyBaseE_val: 0ISS
UniRef100_P29344UniRef Annotation by Michelle Graham. Most informative UniRef hit: 30S ribosomal protein S1, chloroplastic n=1 Tax=Spinacia oleracea RepID=RR1_SPIOL SoyBaseE_val: 0ISS

Expression Patterns of Glyma17g04190
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g04190
ParalogEvidenceComments
Glyma07g36380 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g04190 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g037700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g04190
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g04190
>Glyma17g04190.1   sequence type=CDS   gene model=Glyma17g04190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGTCTCTGCCTCTGCAATTCAGCGGGCTCAAGTGCTCCCCACTCTCATCTTCTTCTCTCTTCTCCAAACCTTCTCTTTGGACCCAACAATCCCAAAAGCGCGTTTCAATTACCATTGCGAACTCAATAGCAATAGCCAATGCGCAGAACAAAGAGAGAGCGAGGCTTAAGAAACTCTTCGAAGAAGCCTACGAGAGATGCCGCAATGCTCCAATGGAAGGTGTTTCCTTCACCATCGAAGACTTCACTGCTGCTCTTGACAAGTACGACTTCGATTCTGAAGTTGGCGGCAAGATTAAAGGCACTGTGTTCTACACAGATAACAATGGAGCAGTTGTTGATATCACTGCAAAGTCTTCGGCATATTTGCCACTGCAAGAGGCGTGCATCCACAGGGTTAAGCATGTTGAAGAAGCAGGCTTAGTTCCTGGGTTCAAAGAGGAGTTTTTGATCATTGGTGAGAACTCAATAGATGATAGCTTGGTCTTGAGTTTAAGGTCTCTTCAGTTTGACCTTGCATGGGAACGTTGTAGACAGCTTCAAGCTGAAGATGTCACAGTCAAGGGTAAGATTGTGGGGGTGAACAAAGGTGGAGTGGTGGCTGAGTTGGAAGGGCTTAGAGGGTTTGTTCCATTGTCTCAAATATCAACGAACTCAAATGTAGAAGAGCTTCTTGATAAGGAGCTTCCTCTTAAGTTTGTGGAGGTGGATGAGGAACAATCTAGACTTGTCCTCAGCAACCGCAAGGCCGTAGCTGGCAACCAGGCACAGCTAGGAATTGGATCAGTGGTCACTGGCTCTGTTCAAAGCCTGAAGCCATATGGTGCTTTCATTGACATTGGTGGAATTAATGGCCTCCTTCACGTTAGTCAGATCAGTCATGACCGTGTAACTGATATTTCAACTGTGCTTCAACCTGGTGACATATTAAAGGTGATGATCTTAAGCCATGACCGAGAGAGAGGTCGAGTAAGTCTTTCCACTAAGAAGTTAGAGCCCACACCTGGAGACATGATTCGCAATCCAAAGCTTGTCTTTGAGAAGGCGGAGGAGATGGCTCAGACATTCAGACAGAGAATAGCCCAAGCAGAAGCTATGGCTCGTGCAGACATGCTAAGGTTCCAGCCTGAGAGTGGATTGACTATCAGCGGTGATGGGATCCTGGGACCATTTACTTCAGACTTGCCTGAAGAGGGACTGGATTTGAGTGAGGTACCACCAGCTGAAGAATCATGA
Predicted protein sequences of Glyma17g04190
>Glyma17g04190.1   sequence type=predicted peptide   gene model=Glyma17g04190   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGSLPLQFSGLKCSPLSSSSLFSKPSLWTQQSQKRVSITIANSIAIANAQNKERARLKKLFEEAYERCRNAPMEGVSFTIEDFTAALDKYDFDSEVGGKIKGTVFYTDNNGAVVDITAKSSAYLPLQEACIHRVKHVEEAGLVPGFKEEFLIIGENSIDDSLVLSLRSLQFDLAWERCRQLQAEDVTVKGKIVGVNKGGVVAELEGLRGFVPLSQISTNSNVEELLDKELPLKFVEVDEEQSRLVLSNRKAVAGNQAQLGIGSVVTGSVQSLKPYGAFIDIGGINGLLHVSQISHDRVTDISTVLQPGDILKVMILSHDRERGRVSLSTKKLEPTPGDMIRNPKLVFEKAEEMAQTFRQRIAQAEAMARADMLRFQPESGLTISGDGILGPFTSDLPEEGLDLSEVPPAEES*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo