SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g04020

Feature Type:gene_model
Chromosome:Gm17
Start:2664543
stop:2665097
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g04020
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G17130AT Annotation by Michelle Graham. TAIR10: Plant invertase/pectin methylesterase inhibitor superfamily protein | chr3:5844495-5845046 REVERSE LENGTH=183 SoyBaseE_val: 8.00E-38ISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0004857GO-mf Annotation by Michelle Graham. GO Molecular Function: enzyme inhibitor activity SoyBaseN/AISS
GO:0030599GO-mf Annotation by Michelle Graham. GO Molecular Function: pectinesterase activity SoyBaseN/AISS
GO:0046910GO-mf Annotation by Michelle Graham. GO Molecular Function: pectinesterase inhibitor activity SoyBaseN/AISS
PF04043PFAM Plant invertase/pectin methylesterase inhibitor JGI ISS
UniRef100_G7JP01UniRef Annotation by Michelle Graham. Most informative UniRef hit: Pectinesterase inhibitor n=1 Tax=Medicago truncatula RepID=G7JP01_MEDTR SoyBaseE_val: 9.00E-92ISS
UniRef100_UPI000233F3A2UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233F3A2 related cluster n=1 Tax=unknown RepID=UPI000233F3A2 SoyBaseE_val: 2.00E-131ISS

Expression Patterns of Glyma17g04020
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g04020
ParalogEvidenceComments
Glyma07g36590 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g04020 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g036100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g04020
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g04020
>Glyma17g04020.2   sequence type=CDS   gene model=Glyma17g04020   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGGTGGAGCTCACTCTTTGTGCCCTCTTTTCTACTCCATATTCTTCTTCTATCTTGCATTCTTTTCACACCAACTGATTCCTCTGATGGGGATGGGGATGGGGATTTGGTAGACCAAATATGCAAAAAAACACCCTTTTATGACCTTTGCAGCTCCATCTTACACTCAAATCCCTTAGCCCCCAAAAGTGATCCAAAGGGTATGGCCCTCATAATGGTCAATGGAATTCTGACAAATGCTACTGACACACTCAGTTACATTGAAGAGCTTATCAAGCAGACCTCAGATGAACAATTAGAGCAACAGTTGGCTTTCTGTGCTGAGTCATACATCCCAGTTGTGAAGTACATTCTCCCACAAGCAGCTGATGCCATAAACCAAGGTCGATTTGGGTTTGCCAGTTACTGCATAGTTGATGCTCAGAAGGAAGTAAATGCTTGCGACAAGAAATTCTCGGGCTCAACTCAAGCACCCTTAAGTGATAGAAATGACATTATGCAGAAGCTGGTGGATGTGGCTGCTGCCATAATTAAACTATTATTAAATGGCTGA
Predicted protein sequences of Glyma17g04020
>Glyma17g04020.2   sequence type=predicted peptide   gene model=Glyma17g04020   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRWSSLFVPSFLLHILLLSCILFTPTDSSDGDGDGDLVDQICKKTPFYDLCSSILHSNPLAPKSDPKGMALIMVNGILTNATDTLSYIEELIKQTSDEQLEQQLAFCAESYIPVVKYILPQAADAINQGRFGFASYCIVDAQKEVNACDKKFSGSTQAPLSDRNDIMQKLVDVAAAIIKLLLNG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo