SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g03610

Feature Type:gene_model
Chromosome:Gm17
Start:2411435
stop:2414104
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g03610
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G17000AT Annotation by Michelle Graham. TAIR10: ubiquitin-conjugating enzyme 32 | chr3:5797296-5799467 FORWARD LENGTH=309 SoyBaseE_val: 2.00E-132ISS
GO:0006301GO-bp Annotation by Michelle Graham. GO Biological Process: postreplication repair SoyBaseN/AISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0006635GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation SoyBaseN/AISS
GO:0009407GO-bp Annotation by Michelle Graham. GO Biological Process: toxin catabolic process SoyBaseN/AISS
GO:0016036GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to phosphate starvation SoyBaseN/AISS
GO:0019375GO-bp Annotation by Michelle Graham. GO Biological Process: galactolipid biosynthetic process SoyBaseN/AISS
GO:0042631GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to water deprivation SoyBaseN/AISS
GO:0043161GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0045892GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0080129GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0004842GO-mf Annotation by Michelle Graham. GO Molecular Function: ubiquitin-protein ligase activity SoyBaseN/AISS
GO:0016881GO-mf Annotation by Michelle Graham. GO Molecular Function: acid-amino acid ligase activity SoyBaseN/AISS
KOG0428 KOG Non-canonical ubiquitin conjugating enzyme 1 JGI ISS
PTHR24067Panther UBIQUITIN-CONJUGATING ENZYME E2 JGI ISS
PTHR24067:SF15Panther JGI ISS
PF00179PFAM Ubiquitin-conjugating enzyme JGI ISS
UniRef100_G7JMU6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ubiquitin carrier protein E2 n=1 Tax=Medicago truncatula RepID=G7JMU6_MEDTR SoyBaseE_val: 0ISS
UniRef100_I1MRQ0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MRQ0_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma17g03610
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g03610
ParalogEvidenceComments
Glyma07g36950 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g03610 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g032800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g03610
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g03610
>Glyma17g03610.1   sequence type=CDS   gene model=Glyma17g03610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGGAGAAACACAACCTTAAGAATCCAGCTGTGAAGCGGATTCTCCAAGAGCTCAAGGAGATGCAATCAAACCCATCCGATGACTACCTGAGCCTCCCTCTTGAGGAAAATATATTTGAATGGCAATTTGCTATAAGGGGGCCTCGTGATACTGAATTTGAAGGTGGTATTTATCACGGACGGATTCAGCTGCCTTCAGAATATCCCTTCAAACCTCCTTCGTTTATGTTGCTCACACCTAGTGGCCGTTTTGAGACCCAAACCAAGATTTGCTTGAGCATATCAAATCATCACCCTGAGCATTGGCAACCATCATGGAGCGTAAGGACTGCTTTAGTCGCACTGATTGCATTCATGCCCACCAACCCAAATGGCGCGTTGGGCTCATTAAACTACAAGAAAGAAGACAGGCGTGCCTTGGCCATTAAATCCCGTGAAGCACCTCCAAAATTTGGGACTCCTGAACGTCAAAGACTGATTGATGAGATACACGAGTATATGCTAAGCAAGTCATCCCCCGTTCCACAACTTGCCCCCTCACAAGTTTCTGAAGAACATTCCAAAACTGAGGAGGCTGAGGCTGAGGCCCAGGTTAATTTACATAATCCTGAAGCTTTACCTGCGGGAGTGGAGATTCCAGATCAAGCAGGCGACAGAGTTGTTGAAGAACAAGAACTCCCTGTCAATGTTAATTCTAACCCTGCAGGAGTTGAAGCTTCAATGGATAATTCATCCAGCGGCTCAAGTAACCAGTTGCTCCAAAAGTCAGATGCAAGGGTTCAAAATCTGAAACCAGAGACAAGGATTCAAAAATCTGACGATCGATTGTTTACACTTGCTGCTATTGGGCTTACTATAGCAATTGTGGTTCTTTTGCTGAAGAAGTTCATTAAATCTACAGAATATGGTGCTGTTTTCATGGATGAATCTTAG
Predicted protein sequences of Glyma17g03610
>Glyma17g03610.1   sequence type=predicted peptide   gene model=Glyma17g03610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAEKHNLKNPAVKRILQELKEMQSNPSDDYLSLPLEENIFEWQFAIRGPRDTEFEGGIYHGRIQLPSEYPFKPPSFMLLTPSGRFETQTKICLSISNHHPEHWQPSWSVRTALVALIAFMPTNPNGALGSLNYKKEDRRALAIKSREAPPKFGTPERQRLIDEIHEYMLSKSSPVPQLAPSQVSEEHSKTEEAEAEAQVNLHNPEALPAGVEIPDQAGDRVVEEQELPVNVNSNPAGVEASMDNSSSGSSNQLLQKSDARVQNLKPETRIQKSDDRLFTLAAIGLTIAIVVLLLKKFIKSTEYGAVFMDES*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo