Report for Sequence Feature Glyma17g03580
Feature Type: gene_model
Chromosome: Gm17
Start: 2401722
stop: 2403398
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma17g03580
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G49400 AT
Annotation by Michelle Graham. TAIR10: zinc knuckle (CCHC-type) family protein | chr5:20031154-20031981 FORWARD LENGTH=275
SoyBase E_val: 3.00E-59 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005575 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cellular component
SoyBase N/A ISS
GO:0003676 GO-mf
Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding
SoyBase N/A ISS
GO:0008270 GO-mf
Annotation by Michelle Graham. GO Molecular Function: zinc ion binding
SoyBase N/A ISS
PTHR13491 Panther
ZCCHC10 PROTEIN
JGI ISS
UniRef100_B9RZN5 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Zinc finger protein, putative n=1 Tax=Ricinus communis RepID=B9RZN5_RICCO
SoyBase E_val: 5.00E-84 ISS
UniRef100_I1MRP8 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MRP8_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma17g03580
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma17g03580
Paralog Evidence Comments
Glyma07g37020 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma17g03580 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.17g032500 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma17g03580
Coding sequences of Glyma17g03580
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma17g03580.1 sequence type=CDS gene model=Glyma17g03580 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTCTAGTAAGAAGGAAGAGAAATCTCAGGCTGCGGCTGAAAGAATCAAGGCTGCAGCCCTGAGTGCTGCGAAAGGCCTTAGTCGTGCCCAGGCTGAAAGGGCTGCGACTGCAGCTGCCCGAAACGTCAATGCTTATGGGCAGAAGGAAGAAGGGCCCAGCAGATGGCAGGAGAAAAGGGAAGCAAAGAGGCAGATGTATTTGATGAGTACCGAAAAAGCTGTTAAATTGGGGGAAAGAAAAGACCTCAAGCCTGCAATGTCGGCAGCCGGTGGATTGGCTCAGTGCCAAAAGTGTTTCCAAAGTGGCCACTGGACATACGAATGCAAGAATGAACGGGTTTACATTTCAAGGCCATCCCGGACCCAGCAACTTAAAAACCCTAAATTGAGGGTGAATGTGTCTGTGACTTATGATTTGGATGATAATATTCCTGATGCTAAGGAGGAAAAGGCAAAAACAAGTTCCAAAAAAACCAAAAGGAAGCATCGGAAGGACTCTGATTCTGCTAGTGATAGTGAGGATTCTGTTTTCGAGACTGATAGTGGCAGTGGGTCATCATCTGTTACGGGATCAGATTATTCTTCAGAAAGTAGTTCAGGTTACAGTTCATCTTCTGATTCAGAGGAGGAACGGAGACGGAGGAGAAAGAAGAAGCAGAAGAGAGGGAGACGCAAGAGGTACACTTCATCAGAATCATCTGATTCAGATTCTGCTTCAGACTCTGATTCCGATGATAAAAGCAGCCGGAGAAAGAAGAGGAATAATCGAAGACGTTGA
Predicted protein sequences of Glyma17g03580
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma17g03580.1 sequence type=predicted peptide gene model=Glyma17g03580 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSSKKEEKSQAAAERIKAAALSAAKGLSRAQAERAATAAARNVNAYGQKEEGPSRWQEKREAKRQMYLMSTEKAVKLGERKDLKPAMSAAGGLAQCQKCFQSGHWTYECKNERVYISRPSRTQQLKNPKLRVNVSVTYDLDDNIPDAKEEKAKTSSKKTKRKHRKDSDSASDSEDSVFETDSGSGSSSVTGSDYSSESSSGYSSSSDSEEERRRRRKKKQKRGRRKRYTSSESSDSDSASDSDSDDKSSRRKKRNNRRR*