Glyma17g03365 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g03365

Feature Type:	gene_model
Chromosome:	Gm17
Start:	2228429
stop:	2229478
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g03365

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G24020	AT	Annotation by Michelle Graham. TAIR10: MLP-like protein 423 \| chr1:8500653-8501458 REVERSE LENGTH=155	SoyBase	E_val: 9.00E-10	ISS
GO:0006952	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response	SoyBase	N/A	ISS
GO:0016556	GO-bp	Annotation by Michelle Graham. GO Biological Process: mRNA modification	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
PF00407	PFAM	Pathogenesis-related protein Bet v I family	JGI		ISS
UniRef100_C6T3A2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T3A2_SOYBN	SoyBase	E_val: 3.00E-108	ISS
UniRef100_P26987	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Stress-induced protein SAM22 n=3 Tax=Glycine max RepID=SAM22_SOYBN	SoyBase	E_val: 1.00E-100	ISS

Expression Patterns of Glyma17g03365

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g03365 not represented in the dataset	Glyma17g03365 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g03365

Paralog	Evidence	Comments
Glyma07g37240	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g03365 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g030400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g03365

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g03365

Limit To All Plant Sequences

>Glyma17g03365.1   sequence type=CDS   gene model=Glyma17g03365   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTATTTTCACATTCGAGGACGAAATCACCTCCCCTGTGGCTCCTGCTACTCTTTACAAAGCTCTAGTTACAGATGCCGACAACATCATCCCAAAGGCTCTTGATTCCTTCAAGAGTGTTGAAAACGTTGAGGGAAATGGTGGCCCTGGAACAATCAAGAAGATAACTTTCGTTGAGGATGGAGAAACCAAGTTTGTACTGCACAAGATAGAAGCAGTTGATGAGGCAAACTTGGGATATAGCTACAGCGTAGTGGGTGGTGCTGCGTTGCCAGACACAGCGGAGAAGATCACATTCCACTCCAAATTGGCTGCTGGTCCCAATGGAGGCTCTGCTGGCAAGCTCACTGTCGAATACCAAACCAAAGGAGATGCTCAGCCCAACCAAGACCAACTCAAAACTGGAAAAGCCAAGGCTGATGCTCTCTTCAAGGCCATTGAGGCTTACCTTTTGGCCAATCCCGATTACAACTAA

Predicted protein sequences of Glyma17g03365

Limit To All Plant Sequences

>Glyma17g03365.1   sequence type=predicted peptide   gene model=Glyma17g03365   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGIFTFEDEITSPVAPATLYKALVTDADNIIPKALDSFKSVENVEGNGGPGTIKKITFVEDGETKFVLHKIEAVDEANLGYSYSVVGGAALPDTAEKITFHSKLAAGPNGGSAGKLTVEYQTKGDAQPNQDQLKTGKAKADALFKAIEAYLLANPDYN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain