SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g03191): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g03191): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g03191

Feature Type:gene_model
Chromosome:Gm17
Start:2142736
stop:2142957
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g03191
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G07820AT Annotation by Michelle Graham. TAIR10: Pectin lyase-like superfamily protein | chr3:2496597-2498028 REVERSE LENGTH=391 SoyBaseE_val: 1.00E-14ISS
GO:0005975GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0004650GO-mf Annotation by Michelle Graham. GO Molecular Function: polygalacturonase activity SoyBaseN/AISS
PF00295PFAM Glycosyl hydrolases family 28 JGI ISS
UniRef100_I1KMW6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1KMW6_SOYBN SoyBaseE_val: 2.00E-31ISS
UniRef100_Q9MBB8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Polygalacturonase n=1 Tax=Salix gilgiana RepID=Q9MBB8_SALGI SoyBaseE_val: 4.00E-14ISS

Expression Patterns of Glyma17g03191
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g03191 not represented in the dataset
Glyma17g03191 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g03191
ParalogEvidenceComments
Glyma07g37440 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g03191 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma17g03191
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g03191
>Glyma17g03191.1   sequence type=CDS   gene model=Glyma17g03191   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATTATCAAGAGCTGCTCATTGGCTAGCACAACCAATGGCCTTAGAATCAAAGCATGGCCAGATAGGTATCCAGATGCAGCATCAGATATAAGCTTCAGTGACATTATCATGAAAGATGTCAAAAATCCTATTATCATTGACCAAGAGTATGAATGTTATCCGGACTGCAAAAAGAAGGTACTATTATTTTGGTATGTTGCTCTTACGACGACTCACTTTTAA
Predicted protein sequences of Glyma17g03191
>Glyma17g03191.1   sequence type=predicted peptide   gene model=Glyma17g03191   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
IIKSCSLASTTNGLRIKAWPDRYPDAASDISFSDIIMKDVKNPIIIDQEYECYPDCKKKVLLFWYVALTTTHF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo