|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G15910 | AT | Annotation by Michelle Graham. TAIR10: drought-induced 21 | chr4:9028657-9029269 FORWARD LENGTH=104 | SoyBase | E_val: 2.00E-15 | ISS |
| GO:0009414 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to water deprivation | SoyBase | N/A | ISS |
| GO:0009737 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus | SoyBase | N/A | ISS |
| GO:0009790 | GO-bp | Annotation by Michelle Graham. GO Biological Process: embryo development | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| PF03242 | PFAM | Late embryogenesis abundant protein | JGI | ISS | |
| UniRef100_O24422 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Desiccation protective protein LEA5 n=1 Tax=Glycine max RepID=O24422_SOYBN | SoyBase | E_val: 8.00E-74 | ISS |
| UniRef100_O24422 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Desiccation protective protein LEA5 n=1 Tax=Glycine max RepID=O24422_SOYBN | SoyBase | E_val: 8.00E-74 | ISS |
|
Glyma17g03040 not represented in the dataset |
Glyma17g03040 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.17g027400 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma17g03040.1 sequence type=CDS gene model=Glyma17g03040 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCCCGTTCTCTCTCGCAAGCCAAACGTATTGGTGTCCTTGTTGCTCAATCTATCTCCCTAATTCCCGTTCATCGGCGAGGTTACGCAGTGGCATCCGATGTATCGGTAAGAGTTGGATTGGGTAATATTGGGCGAAGGAATGGAATCGTGGGAGGTGTAGAAGAGAAGCCTGATACAAGAGATGGTTCAAAAGCCTACTCAACTGATTGGGCCCCAGACCCAGTAACAGGTTACTATAGGCCCATTAACCACACCCCTGAAATTGACCCGGTGGAGCTTCGGCATAGGTTGCTCCGATCACCTCCACTAGAGCCTAGAGGAGTTGCTGGACACCCATGA
>Glyma17g03040.1 sequence type=predicted peptide gene model=Glyma17g03040 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MARSLSQAKRIGVLVAQSISLIPVHRRGYAVASDVSVRVGLGNIGRRNGIVGGVEEKPDTRDGSKAYSTDWAPDPVTGYYRPINHTPEIDPVELRHRLLRSPPLEPRGVAGHP*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||