SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g03040

Feature Type:gene_model
Chromosome:Gm17
Start:2031606
stop:2032478
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g03040
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G15910AT Annotation by Michelle Graham. TAIR10: drought-induced 21 | chr4:9028657-9029269 FORWARD LENGTH=104 SoyBaseE_val: 2.00E-15ISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009790GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF03242PFAM Late embryogenesis abundant protein JGI ISS
UniRef100_O24422UniRef Annotation by Michelle Graham. Best UniRef hit: Desiccation protective protein LEA5 n=1 Tax=Glycine max RepID=O24422_SOYBN SoyBaseE_val: 8.00E-74ISS
UniRef100_O24422UniRef Annotation by Michelle Graham. Most informative UniRef hit: Desiccation protective protein LEA5 n=1 Tax=Glycine max RepID=O24422_SOYBN SoyBaseE_val: 8.00E-74ISS

Expression Patterns of Glyma17g03040
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g03040 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g027400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g03040
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g03040
>Glyma17g03040.1   sequence type=CDS   gene model=Glyma17g03040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCCGTTCTCTCTCGCAAGCCAAACGTATTGGTGTCCTTGTTGCTCAATCTATCTCCCTAATTCCCGTTCATCGGCGAGGTTACGCAGTGGCATCCGATGTATCGGTAAGAGTTGGATTGGGTAATATTGGGCGAAGGAATGGAATCGTGGGAGGTGTAGAAGAGAAGCCTGATACAAGAGATGGTTCAAAAGCCTACTCAACTGATTGGGCCCCAGACCCAGTAACAGGTTACTATAGGCCCATTAACCACACCCCTGAAATTGACCCGGTGGAGCTTCGGCATAGGTTGCTCCGATCACCTCCACTAGAGCCTAGAGGAGTTGCTGGACACCCATGA
Predicted protein sequences of Glyma17g03040
>Glyma17g03040.1   sequence type=predicted peptide   gene model=Glyma17g03040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MARSLSQAKRIGVLVAQSISLIPVHRRGYAVASDVSVRVGLGNIGRRNGIVGGVEEKPDTRDGSKAYSTDWAPDPVTGYYRPINHTPEIDPVELRHRLLRSPPLEPRGVAGHP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo