SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g02911): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g02911): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g02911

Feature Type:gene_model
Chromosome:Gm17
Start:1934909
stop:1938103
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G16565AT Annotation by Michelle Graham. TAIR10: alanine-tRNA ligases;nucleic acid binding;ligases, forming aminoacyl-tRNA and related compounds;nucleotide binding;ATP binding | chr3:5640531-5642675 REVERSE LENGTH=256 SoyBaseE_val: 1.00E-40ISS
GO:0006419GO-bp Annotation by Michelle Graham. GO Biological Process: alanyl-tRNA aminoacylation SoyBaseN/AISS
GO:0043039GO-bp Annotation by Michelle Graham. GO Biological Process: tRNA aminoacylation SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0004813GO-mf Annotation by Michelle Graham. GO Molecular Function: alanine-tRNA ligase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
PTHR11777Panther ALANYL-TRNA SYNTHETASE JGI ISS
PTHR11777:SF2Panther ALANYL-TRNA SYNTHETASE JGI ISS
PF01411PFAM tRNA synthetases class II (A) JGI ISS
UniRef100_G7JLH0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Alanyl-tRNA synthetase n=1 Tax=Medicago truncatula RepID=G7JLH0_MEDTR SoyBaseE_val: 6.00E-72ISS
UniRef100_UPI000233E3A4UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E3A4 related cluster n=1 Tax=unknown RepID=UPI000233E3A4 SoyBaseE_val: 2.00E-105ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g02911 not represented in the dataset

Glyma17g02911 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma07g37720 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma17g02911.1   sequence type=CDS   gene model=Glyma17g02911   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATAAGAATCAGACGAAGCTGGAATACTTTGATGAGATGTGGAGGCTCCAATGCACTGCCACACTATTATCTCACTTGAAGGAGGATGATGATGGTCGGCATGTTTTGATATTGGATCGTACAATATTCTATCCGCAAGGAGGTGGTCAACCACCAGATACTGGCTTTCTACTCATTCATGGCTTTGACAACAACAAATTTCTGGTCTTTCACTATGGTTTCTTTGAGAACCTAGGTGGGAAATTTGAGCCTACACTCGAGAAAGGGAAGGAGGTTTCACTGTTTGTTGATGAGTTCAGACGAAAACTGAACTCCAGGTTTAAATTTTTGCAGACCATGAAATTCTTCAATTTTCTCTTGAATATGCAGAGTAAGCAAAAGGATTTAGAGCTGGAGGCCAATGCATTAATTTCCGTGGGAGGAAAAGTTTCCGTTGATATATTACCGTATGATGAAGCTGCTAAGCTTTGCGGTGGGTGTCTTCCTGATTATGTTCCCAAGAAGATTCACGCTTATGGTGTTCTATCCACTTTGAACTTTGTAGAAGTCCTCATAAGTCATAAATATGAAATTTTTTTCTTGAAAATGGAAGAAATTCTCTTTCCAGTCATTGTGAAAGTGATAAAATCATTTCAAGCCTTAATATCAGTATCAGTTAAGGAATACAACTGTTTTCCCTTTGCTGCCTTCTTGGTTTATCAAATTCGCTCAAAGAAGGGGCTGACAAAAGTCTTTTACAATGTTGAATCCTAG

>Glyma17g02911.1   sequence type=predicted peptide   gene model=Glyma17g02911   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDKNQTKLEYFDEMWRLQCTATLLSHLKEDDDGRHVLILDRTIFYPQGGGQPPDTGFLLIHGFDNNKFLVFHYGFFENLGGKFEPTLEKGKEVSLFVDEFRRKLNSRFKFLQTMKFFNFLLNMQSKQKDLELEANALISVGGKVSVDILPYDEAAKLCGGCLPDYVPKKIHAYGVLSTLNFVEVLISHKYEIFFLKMEEILFPVIVKVIKSFQALISVSVKEYNCFPFAAFLVYQIRSKKGLTKVFYNVES*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo