Report for Sequence Feature Glyma17g02820
Feature Type: gene_model
Chromosome: Gm17
Start: 1868212
stop: 1870846
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma17g02820
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G49660 AT
Annotation by Michelle Graham. TAIR10: Transducin/WD40 repeat-like superfamily protein | chr3:18413690-18415223 FORWARD LENGTH=317
SoyBase E_val: 2.00E-175 ISS
GO:0007186 GO-bp
Annotation by Michelle Graham. GO Biological Process: G-protein coupled receptor signaling pathway
SoyBase N/A ISS
GO:0010228 GO-bp
Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0005834 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: heterotrimeric G-protein complex
SoyBase N/A ISS
GO:0048188 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: Set1C/COMPASS complex
SoyBase N/A ISS
GO:0000166 GO-mf
Annotation by Michelle Graham. GO Molecular Function: nucleotide binding
SoyBase N/A ISS
GO:0042393 GO-mf
Annotation by Michelle Graham. GO Molecular Function: histone binding
SoyBase N/A ISS
KOG0266
KOG
WD40 repeat-containing protein
JGI ISS
PTHR22847 Panther
WD40 REPEAT PROTEIN
JGI ISS
PTHR22847:SF117 Panther
SUBFAMILY NOT NAMED
JGI ISS
PF00400 PFAM
WD domain, G-beta repeat
JGI ISS
UniRef100_G7JKD3 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: WD repeat-containing protein n=1 Tax=Medicago truncatula RepID=G7JKD3_MEDTR
SoyBase E_val: 0 ISS
UniRef100_I1MRH1 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1MRH1_SOYBN
SoyBase E_val: 0 ISS
Expression Patterns of Glyma17g02820
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma17g02820
Paralog Evidence Comments
Glyma07g37820 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma17g02820 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.17g025400 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma17g02820
Coding sequences of Glyma17g02820
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma17g02820.1 sequence type=CDS gene model=Glyma17g02820 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGACGACGGAAGCAACAGTAAAAGCATTTTCGGATTCGGATTCAGATTCCATGAAGCCCAACTACACTCTTTCCCAAACCCTAAGCGGCCACAAGCGCGCCATCTCGGCCGTAAAATTCTCCTCCAATGGGCGCCTCCTCGCCTCCTCCGCCGCCGACAAGACCCTCCGAACCTATGGCTTCACGAACTCCGACTCGGACTCCGAGAGCCTGACGCTGTCCCCGATGCAGCAGTACGAGGGCCACGAGCAGGGCGTTTCCGACCTCGCCTTCTCGTCGGACTCCCGGTTCCTTGTGTCAGCCTCCGACGACAAGACTCTCCGGCTCTGGGACGTGCCGACTGGGTCCCTCATAAAGACCCTCCACGGGCACACCAACTACGTGTTCTGCGTGAACTTCAACCCGCAGTCCAACATCATCGTCTCCGGTTCCTTCGACGAGACCGTTAGGGTTTGGGACGTCAAGTCCGGGAAGTGCCTCAAGGTTCTCCCCGCGCACTCCGACCCTGTCACCGCCGTTGACTTCAACCGCGACGGCTCCCTCATCGTCTCCAGCAGCTACGACGGCCTCTGCCGAATCTGGGACGCCTCCACCGGCCACTGTATGAAGACTCTCATCGACGACGACAACCCTCCTGTTTCCTTTGTCAAGTTTTCCCCCAACGCCAAGTTCATTCTCGTTGGCACCTTGGACAACACTCTGAGGCTTTGGAACTATTCAACTGGGAAGTTTCTAAAGACTTACACCGGTCATGTTAATTCAAAATACTGCATTTCATCCACTTTTTCTACAACAAATGGGAAATATATTGTTGGCGGTTCAGAAGAAAATTATATATACTTGTGGGATTTGCAGTCAAGGAAAATAGTGCAGAAATTAGAAGGGCATTCTGATGCTGTTGTTTCTGTGTCATGTCACCCTACAGAGAACATGATTGCTTCTGGTGCACTTGGCAATGACAACACTGTGAAGATCTGGACTCAGCAGAAAGACTGA
Predicted protein sequences of Glyma17g02820
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma17g02820.1 sequence type=predicted peptide gene model=Glyma17g02820 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MTTEATVKAFSDSDSDSMKPNYTLSQTLSGHKRAISAVKFSSNGRLLASSAADKTLRTYGFTNSDSDSESLTLSPMQQYEGHEQGVSDLAFSSDSRFLVSASDDKTLRLWDVPTGSLIKTLHGHTNYVFCVNFNPQSNIIVSGSFDETVRVWDVKSGKCLKVLPAHSDPVTAVDFNRDGSLIVSSSYDGLCRIWDASTGHCMKTLIDDDNPPVSFVKFSPNAKFILVGTLDNTLRLWNYSTGKFLKTYTGHVNSKYCISSTFSTTNGKYIVGGSEENYIYLWDLQSRKIVQKLEGHSDAVVSVSCHPTENMIASGALGNDNTVKIWTQQKD*