SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g02391

Feature Type:gene_model
Chromosome:Gm17
Start:1543718
stop:1544578
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g02391
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G21550AT Annotation by Michelle Graham. TAIR10: DUF679 domain membrane protein 2 | chr3:7591708-7592262 REVERSE LENGTH=184 SoyBaseE_val: 2.00E-13ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0009705GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type vacuole membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF05078PFAM Protein of unknown function (DUF679) JGI ISS
UniRef100_Q10KU0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Expressed protein n=1 Tax=Oryza sativa Japonica Group RepID=Q10KU0_ORYSJ SoyBaseE_val: 8.00E-11ISS
UniRef100_UPI000233F0B0UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233F0B0 related cluster n=1 Tax=unknown RepID=UPI000233F0B0 SoyBaseE_val: 4.00E-76ISS

Expression Patterns of Glyma17g02391
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g02391 not represented in the dataset
Glyma17g02391 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g02391
ParalogEvidenceComments
Glyma07g38370 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g02391 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g020800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g02391
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g02391
>Glyma17g02391.1   sequence type=CDS   gene model=Glyma17g02391   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGAAATGAAGCCATTTTACTTAGAATCGAGCAAGTCCCCTATCTCTTCTTTTATTTTTTATTTGTTACACCAACTCCGTATTTGTGTACACAAGCGAATAATACGCGTATGTGCATGTGTACCTGGAAATCTGCAACTGACAGACTCAAGTTTGGAGATTTCGTGCATGCCGTTTTATCCTTGTTAGTGTTTGCGGTATTAGGGCTATTGGATACCAACACTCAGAGGCTTCTGCTTCAGGTGTTGCCCACAGTTATTGGGGTATTAGCGGCTGGACACTTCGTTATTTCCCCCACTAATCGTCATGGAATTCGATACCCTTTAACTTCTGATTCTAACACCACCTCCCCAAAACTCAATGATACCGCACCTCCACAAATTCTGAACGACACTGTTTGGCATTACTTTTTTTTTCTGGTAATGATGTTGTTGGCTTATAGCAACTTGCGCCTTCGAAAATATTGGCGCATGCTGCTACTGCTTGCTATGTATGTACCTGCATCAGCATGGTATGAAATGTTATAG
Predicted protein sequences of Glyma17g02391
>Glyma17g02391.1   sequence type=predicted peptide   gene model=Glyma17g02391   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRNEAILLRIEQVPYLFFYFLFVTPTPYLCTQANNTRMCMCTWKSATDRLKFGDFVHAVLSLLVFAVLGLLDTNTQRLLLQVLPTVIGVLAAGHFVISPTNRHGIRYPLTSDSNTTSPKLNDTAPPQILNDTVWHYFFFLVMMLLAYSNLRLRKYWRMLLLLAMYVPASAWYEML*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo