Report for Sequence Feature Glyma17g02200
Feature Type: gene_model
Chromosome: Gm17
Start: 1402450
stop: 1404212
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma17g02200
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G59850 AT
Annotation by Michelle Graham. TAIR10: Ribosomal protein S8 family protein | chr5:24112499-24113084 REVERSE LENGTH=130
SoyBase E_val: 3.00E-91 ISS
GO:0001510 GO-bp
Annotation by Michelle Graham. GO Biological Process: RNA methylation
SoyBase N/A ISS
GO:0006412 GO-bp
Annotation by Michelle Graham. GO Biological Process: translation
SoyBase N/A ISS
GO:0009664 GO-bp
Annotation by Michelle Graham. GO Biological Process: plant-type cell wall organization
SoyBase N/A ISS
GO:0042545 GO-bp
Annotation by Michelle Graham. GO Biological Process: cell wall modification
SoyBase N/A ISS
GO:0005618 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cell wall
SoyBase N/A ISS
GO:0005622 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: intracellular
SoyBase N/A ISS
GO:0005840 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: ribosome
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0016020 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: membrane
SoyBase N/A ISS
GO:0022627 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytosolic small ribosomal subunit
SoyBase N/A ISS
GO:0003735 GO-mf
Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome
SoyBase N/A ISS
KOG1754
KOG
40S ribosomal protein S15/S22
JGI ISS
PTHR11758 Panther
30S RIBOSOMAL PROTEIN S8
JGI ISS
PF00410 PFAM
Ribosomal protein S8
JGI ISS
UniRef100_C6F117 UniRef
Annotation by Michelle Graham. Best UniRef hit: Putative ribosomal protein S15 n=1 Tax=Glycine max RepID=C6F117_SOYBN
SoyBase E_val: 1.00E-89 ISS
UniRef100_I3NML3 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: 40S ribosomal protein S15C n=3 Tax=Euphorbiaceae RepID=I3NML3_HEVBR
SoyBase E_val: 2.00E-89 ISS
Expression Patterns of Glyma17g02200
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma17g02200
Paralog Evidence Comments
Glyma07g38520 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma17g02200 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.17g018600 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma17g02200
Coding sequences of Glyma17g02200
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma17g02200.1 sequence type=CDS gene model=Glyma17g02200 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGTGAGGGTTAGTGTGCTGAACGATGCTCTGAAGAGCATGTACAATGCTGAGAAAAGGGGAAAGCGCCAAGTCATGATTAGGCCATCCTCCAAAGTCATTATCAAATTCCTTTTGGTGATGCAAAAGCACGGATACATCGGAGAGTTTGAGTATGTTGATGACCACAGGGCTGGTAAAATCGTGGTTGAATTGAACGGTAGACTGAACAAGTGTGGGGTTATTAGTCCCCGTTTTGATGTGGGCGTCAAAGAGATTGAAGGTTGGACTGCTAGGCTTCTCCCCTCAAGACAGTTTGGGTATATTGTATTGACTACCTCTGCTGGCATCATGGATCATGAAGAGGCTAGGAGGAAAAATGTTGGTGGTAAGGTATTGGGCTTCTTCTACTAG
Predicted protein sequences of Glyma17g02200
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma17g02200.1 sequence type=predicted peptide gene model=Glyma17g02200 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MVRVSVLNDALKSMYNAEKRGKRQVMIRPSSKVIIKFLLVMQKHGYIGEFEYVDDHRAGKIVVELNGRLNKCGVISPRFDVGVKEIEGWTARLLPSRQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY*