SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g02150

Feature Type:gene_model
Chromosome:Gm17
Start:1367754
stop:1371793
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g02150
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G23600AT Annotation by Michelle Graham. TAIR10: alpha/beta-Hydrolases superfamily protein | chr3:8473833-8475655 FORWARD LENGTH=239 SoyBaseE_val: 8.00E-119ISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0006972GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic response SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0009266GO-bp Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0016787GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity SoyBaseN/AISS
KOG3043 KOG Predicted hydrolase related to dienelactone hydrolase JGI ISS
PTHR17630Panther DIENELACTONE HYDROLASE JGI ISS
PTHR17630:SF19Panther ENDO-1,3-1,4-BETA-D-GLUCANASE JGI ISS
PF01738PFAM Dienelactone hydrolase family JGI ISS
UniRef100_C6TJ96UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TJ96_SOYBN SoyBaseE_val: 2.00E-171ISS
UniRef100_E4MVH7UniRef Annotation by Michelle Graham. Most informative UniRef hit: mRNA, clone: RTFL01-01-C03 n=1 Tax=Eutrema halophilum RepID=E4MVH7_THEHA SoyBaseE_val: 2.00E-116ISS

Expression Patterns of Glyma17g02150
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g02150 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g018100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g02150
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g02150
>Glyma17g02150.1   sequence type=CDS   gene model=Glyma17g02150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCAGGGCCTCAGTGCTGTTCAAATCCACCCAGCCTGAACCCCAGTGGAGGAGGTGGGCATGTCAATAAAGTGGGTGGTGTCGATTCCTATTTCAGTGGCTCTTCTCACTCTAAACTCGCCCTTCTTATGCTCTCCGATGTCTTTGGTTATGAAGCACCAAATTTAAGGAAGCTTGCTGACAAAGTTGCAGCTGCTGGGTATTATGTGGTTGTTCCCGACCTCTTGGATGGTGAACCCTTTAATTATCAGAATTCTAACAGACCCTTACCTGTGTGGCTAAAAGATCATGGACCGGACAAAGGTTCTGAAGCTACAAAACCCATAATTGAGGCCTTGAAAAGTAAAGGTGTTTCTGTTATTGCCGCTGTTGGTTTTTGTTGGGGTGCAAAGGTTGTGGTTGAACTTGTAAAGTCCAAACTTATACAAACTGCTGTGCTAATGCATCCATCGTTTGTCTCTCTGGACGACATCAAGGCTGTTGATATTCCAATTGCTATACTCGGAGCTGAGATTGACCAATATTCTCCTCCCGAGCTTGTGAAACAATTTGAACAAGTCCTAGCTGCTAAAGCTGGGGTTGCTAGTTTTGTTAAAATATTTCCCAAAATTTCACACGGTTGGGCTGTGAGATACAACGCTGAAGATGCAGAAGCTGTGAAGGTTGCAGAGGAGGCTCACCGGGACATGTTGGACTGGCTTGCTAAACATCACAAGTGA
Predicted protein sequences of Glyma17g02150
>Glyma17g02150.1   sequence type=predicted peptide   gene model=Glyma17g02150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSGPQCCSNPPSLNPSGGGGHVNKVGGVDSYFSGSSHSKLALLMLSDVFGYEAPNLRKLADKVAAAGYYVVVPDLLDGEPFNYQNSNRPLPVWLKDHGPDKGSEATKPIIEALKSKGVSVIAAVGFCWGAKVVVELVKSKLIQTAVLMHPSFVSLDDIKAVDIPIAILGAEIDQYSPPELVKQFEQVLAAKAGVASFVKIFPKISHGWAVRYNAEDAEAVKVAEEAHRDMLDWLAKHHK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo