SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g02091

Feature Type:gene_model
Chromosome:Gm17
Start:1329494
stop:1333100
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g02091
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G19030AT Annotation by Michelle Graham. TAIR10: RNA-binding (RRM/RBD/RNP motifs) family protein | chr5:6357503-6359081 REVERSE LENGTH=172 SoyBaseE_val: 6.00E-24ISS
GO:0000398GO-bp Annotation by Michelle Graham. GO Biological Process: mRNA splicing, via spliceosome SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
PTHR24012Panther FAMILY NOT NAMED JGI ISS
PF00076PFAM RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) JGI ISS
UniRef100_F4JZK9UniRef Annotation by Michelle Graham. Most informative UniRef hit: RNA recognition motif-containing protein n=1 Tax=Arabidopsis thaliana RepID=F4JZK9_ARATH SoyBaseE_val: 3.00E-21ISS
UniRef100_UPI000233EF39UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233EF39 related cluster n=1 Tax=unknown RepID=UPI000233EF39 SoyBaseE_val: 1.00E-111ISS

Expression Patterns of Glyma17g02091
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g02091 not represented in the dataset
Glyma17g02091 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g02091
ParalogEvidenceComments
Glyma07g38611 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g02091 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g017500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g02091
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g02091
>Glyma17g02091.1   sequence type=CDS   gene model=Glyma17g02091   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATACACCTACATCAATTATGTCATCACCTTCACAAGAAGGGAAGTTGTGAGTTTGTTTCGAAAATCCTTCCGATGGCACAACAAGTTCAAGTTCAAGTATTCAGTACATGTTATTATTGTCCACCACCTCAATATGTATCCCTTCGCCGAATCGGAATTTTGAACCAATTAAAGTGTGCTACTATTCCTTCACTCTCAGTTTCCGCCTCTTCTGTTCTTCGCAACGCGTCGTTTTGCTGCACCTCTTCTGTCCCATGCAATTTGCCTTCTTCACCCAAAATCTTCGTCAAAGGGCTTCCTCTCTCAACCTCCGAAGGACATTTGATGAAGGTGTTTTCAGAGTTTGGTGAAGTTACTCTAATCCAGCTTCCAATAGATAAAGAATCAGGGCAGTCTTTAGGATTTGCATACATTTGGTTTGTCAAGGAAGAGTCTGCACAATTGGCTGTCCTAGAGATGAATGGAAAGTTTTTTTATGGCAGGTTTATTTATGTTACCATTGCAAAGCCTGGATCATCAAAAAGTTCCAAGAGGGCAACGGCCTACAAATTTTAA
Predicted protein sequences of Glyma17g02091
>Glyma17g02091.1   sequence type=predicted peptide   gene model=Glyma17g02091   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIHLHQLCHHLHKKGSCEFVSKILPMAQQVQVQVFSTCYYCPPPQYVSLRRIGILNQLKCATIPSLSVSASSVLRNASFCCTSSVPCNLPSSPKIFVKGLPLSTSEGHLMKVFSEFGEVTLIQLPIDKESGQSLGFAYIWFVKEESAQLAVLEMNGKFFYGRFIYVTIAKPGSSKSSKRATAYKF*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo