Report for Sequence Feature Glyma17g02040
Feature Type: gene_model
Chromosome: Gm17
Start: 1272009
stop: 1273235
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma17g02040
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G06145 AT
Annotation by Michelle Graham. TAIR10: unknown protein; Has 15 Blast hits to 15 proteins in 7 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 15; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr3:1860118-1860618 REVERSE LENGTH=166
SoyBase E_val: 1.00E-44 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_C6T3Q2 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T3Q2_SOYBN
SoyBase E_val: 3.00E-106 ISS
Expression Patterns of Glyma17g02040
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma17g02040
Paralog Evidence Comments
Glyma07g38660 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma17g02040 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.17g017000 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma17g02040
Coding sequences of Glyma17g02040
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma17g02040.1 sequence type=CDS gene model=Glyma17g02040 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGGGAAAGTGCAAGGTTTTAGCCTTCTATCTTTTGGTGGCTGCTTTGATGGTTGTCGTGACCATACTCAAGGCTCTGGTTACGGAACAAGGATATGGAACCTCAGTGATCGACCAGTGGAGCTGCAAATAAGGGTGGGATCAATACTGAAGAAGATTCACACGTTGAAGCCGGGGTCTTCTAAAAGATTGAAATCTAAAAGCATATATAAGGCTTATATGCCTGGGAGGAGTGGCAGTGTCGGTGGTAGCTTGAAGAGCTTATTGTATTACTATGATGAAACATATCACCCTTATATTTGGATTCATGACACAGGGTGTCACTCCTTAAGGATGGCTAAGCAGCAGTATATTAGCCTTGAGGATCTGAGGGATTCTTCTGAGATCAAAGTCTTCTGGGATCATCAGAGAGGTTCTATATCAGTTCGTAAGAGAACAAGGCCAGATTTCTGCTGA
Predicted protein sequences of Glyma17g02040
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma17g02040.1 sequence type=predicted peptide gene model=Glyma17g02040 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MGKVQGFSLLSFGGCFDGCRDHTQGSGYGTRIWNLSDRPVELQIRVGSILKKIHTLKPGSSKRLKSKSIYKAYMPGRSGSVGGSLKSLLYYYDETYHPYIWIHDTGCHSLRMAKQQYISLEDLRDSSEIKVFWDHQRGSISVRKRTRPDFC*