SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma17g01255

Feature Type:gene_model
Chromosome:Gm17
Start:737689
stop:738312
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
UniRef100_G7JKI2UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Medicago truncatula RepID=G7JKI2_MEDTR SoyBaseE_val: 2.00E-19ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g01255 not represented in the dataset

Glyma17g01255 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g008900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma17g01255.1   sequence type=CDS   gene model=Glyma17g01255   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTAGTAGACTCTGCGTTCTGCTGTGTTACCATATATCAGATGGCAACAATTTGAAGAAAGAGAAGCAAGGAATGTATTGCAAGATATCGAAAAGAAAGAAGGAGATGGAGACAGAAGAGAAGAAGGTGGTTCCAAATCTGACTCTAGAAGATTGGATATTAGCTTCTCCTGGTTTGAAGCCAGACTACATTAATATAAGATCAGGAGAATTCTCTTCTTCATGTTCATCTAAGTCTAAGAAAAAGGTGCACCCTTGTGTGAGTCAAGTTCCTAGATCATTGATAGCTGAAGCTAAAGACAGTTTATGCCTGGACAGACCCATGAACCGTAATGAAGAAATGTTAAGTTCCACATCAATTGGTAGAAGCATAAGTGAGAAATCACAGAAAAAAGTGAGCTTTAAACTCCCTCATAATGTCATATTTTACTCACCTGATGAGCCTCGCTCCCCAGAGGAGAAAGAGCCTTATTATTGCTATTATTATAATAGCAGTGAAAGTGAAGACTCATTCTACTCATCAATCTGCAGAGAATATTCATTTGACTCTTCTGCAGAGGAAACCTTGATCAAACTCGCAGTGGATGTTCTTCCTCATGTTTCTGTCTCTTCCAAAATTTGA

>Glyma17g01255.1   sequence type=predicted peptide   gene model=Glyma17g01255   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGSRLCVLLCYHISDGNNLKKEKQGMYCKISKRKKEMETEEKKVVPNLTLEDWILASPGLKPDYINIRSGEFSSSCSSKSKKKVHPCVSQVPRSLIAEAKDSLCLDRPMNRNEEMLSSTSIGRSISEKSQKKVSFKLPHNVIFYSPDEPRSPEEKEPYYCYYYNSSESEDSFYSSICREYSFDSSAEETLIKLAVDVLPHVSVSSKI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo