SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma17g00601

Feature Type:gene_model
Chromosome:Gm17
Start:276613
stop:277618
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G14450AT Annotation by Michelle Graham. TAIR10: NADH dehydrogenase (ubiquinone)s | chr1:4947337-4947558 REVERSE LENGTH=73 SoyBaseE_val: 8.00E-26ISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0009853GO-bp Annotation by Michelle Graham. GO Biological Process: photorespiration SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0080129GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0031966GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial membrane SoyBaseN/AISS
GO:0045271GO-cc Annotation by Michelle Graham. GO Cellular Compartment: respiratory chain complex I SoyBaseN/AISS
GO:0008137GO-mf Annotation by Michelle Graham. GO Molecular Function: NADH dehydrogenase (ubiquinone) activity SoyBaseN/AISS
UniRef100_C6SZG4UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6SZG4_SOYBN SoyBaseE_val: 2.00E-42ISS
UniRef100_Q9M9R9UniRef Annotation by Michelle Graham. Most informative UniRef hit: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3-B n=2 Tax=Arabidopsis RepID=NDB3B_ARATH SoyBaseE_val: 4.00E-23ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g00601 not represented in the dataset

Glyma17g00601 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g002300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma17g00601.2   sequence type=transcript   gene model=Glyma17g00601   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTGGAAGGAAAGAAAGAAAAGCAAAGCAAAGCGAGTGGGTGAGGAGGAAGGAAGGGAGGGAAGAATAGAATGGGATCTGGAAGTGGAAAACACACTGGAGAGTTCTTCAGGAGAAGGGATGCATGGAGGAAGCATCCGATGCTCACCAATCAGCTCCGCCACGCCACCCCTGGCCTTGGCATCGCCGTCGTCGCCTTCGGTATCTACCTCGTCGGCGAACAAGTCTACAATAGGCTCTATGCTCCCGATCCTCATTCGATTTCTCACGTGAAAGCCGGGGATCACCACTAAACGTTTGGACGGACGCACTCCATTCCATCATCACTTAATAAGCTTGCTAGCATGTTCTCGCAGCCTTTAATGTTTAAATTTCAGACCGTGTTCGCTTCTTTGGCACTCACTATGTTGTCTTGTATGCCTACATTTTATGCCTTCAATTTGCATTCACAATGAAACTCAATTTACTTTACTTTTTTCTCTACCTTTATACTTCATTTCGTTCTTGCTATTTCACCTTCAATCCATTTACTCCCTAACTTACTAGGACCAGTGCTGACAATGTTCTAATGTTTAAGTTAGATTCATGCCAATTTTAGGGACAAAAACTGAACTTTCACTCTATGCATGTGAAAATTTAAAACTCCATGAGAGCTGCATAGTGCATATCGATTCCTTCCCTCTTGCCAATGTGGAGTCAAACTGAATTGTAGGATTAGTATCTTTGTTTGCTTCGGGTAATTGAATTCCAGGATTTAGCTCTATTTCTCTAT

>Glyma17g00601.1   sequence type=CDS   gene model=Glyma17g00601   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGATCTGGAAGTGGAAAACACACTGGAGAGTTCTTCAGGAGAAGGGATGCATGGAGGAAGCATCCGATGCTCACCAATCAGCTCCGCCACGCCACCCCTGGCCTTGGCATCGCCGTCGTCGCCTTCGGTATCTACCTCGTCGGCGAACAAGTCTACAATAGGCTCTATGCTCCCGATCCTCATTCGATTTCTCACGTAGCTCTTCTGTTTTCCCTTTTTCAATTCACTTCACACACTCCTTTATCTTATTGA

>Glyma17g00601.2   sequence type=CDS   gene model=Glyma17g00601   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGATCTGGAAGTGGAAAACACACTGGAGAGTTCTTCAGGAGAAGGGATGCATGGAGGAAGCATCCGATGCTCACCAATCAGCTCCGCCACGCCACCCCTGGCCTTGGCATCGCCGTCGTCGCCTTCGGTATCTACCTCGTCGGCGAACAAGTCTACAATAGGCTCTATGCTCCCGATCCTCATTCGATTTCTCACGTGAAAGCCGGGGATCACCACTAA

>Glyma17g00601.1   sequence type=predicted peptide   gene model=Glyma17g00601   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGSGSGKHTGEFFRRRDAWRKHPMLTNQLRHATPGLGIAVVAFGIYLVGEQVYNRLYAPDPHSISHVALLFSLFQFTSHTPLSY*

>Glyma17g00601.2   sequence type=predicted peptide   gene model=Glyma17g00601   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGSGSGKHTGEFFRRRDAWRKHPMLTNQLRHATPGLGIAVVAFGIYLVGEQVYNRLYAPDPHSISHVKAGDHH*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo