SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g34140): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g34140): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma16g34140

Feature Type:gene_model
Chromosome:Gm16
Start:36804317
stop:36805842
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma16g34140
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G32300AT Annotation by Michelle Graham. TAIR10: uclacyanin 1 | chr2:13722510-13723464 FORWARD LENGTH=261 SoyBaseE_val: 2.00E-32ISS
GO:0048765GO-bp Annotation by Michelle Graham. GO Biological Process: root hair cell differentiation SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0031225GO-cc Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
PF02298PFAM Plastocyanin-like domain JGI ISS
UniRef100_G7KLP5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Blue copper protein n=1 Tax=Medicago truncatula RepID=G7KLP5_MEDTR SoyBaseE_val: 6.00E-73ISS
UniRef100_I1MQJ7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MQJ7_SOYBN SoyBaseE_val: 3.00E-157ISS

Expression Patterns of Glyma16g34140
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g34140 not represented in the dataset
Glyma16g34140 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma16g34140
ParalogEvidenceComments
Glyma09g29566 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma16g34140 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.16g215700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma16g34140
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma16g34140
>Glyma16g34140.1   sequence type=CDS   gene model=Glyma16g34140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGAAACTGAGACCAGCGTGGGCCGTTAAGGCGATCATCGTGATCGTGTTCACTTCGATCCTCTTCCGATGCGTCTGCGGCGAGAACCACACCGTCGGTGGAGCTTCCGGCTGGGATCTCGGTTCCAATATCCAAGCCTGGTCTTCTACGACAACGTTTAACGTTGGTGACGATCTCGTGTTCTCATACACGGCGGCGCACGACGTGATGGAAGTGAACCAACTAGATTACGACACGTGTAAGATAGCCAACGCTCTGGCAACGTACGATAACGGAGAGACCGTGATCCACCTGAGCGACGCCAAAACGCGCTACTTCGTATGCGGCCGAATGGGCCATTGCCAACAGGGCCTTAAACTACAGGTCCAAATTTTAGCCCAGTCCAATAACGGAACCAGCAATGATCAAAACCAAAGCCCCGGCGGTTCTCCTCCGTCTACTTCTCCTCCTCCTCCGCCGCCGCCGCCGCCGCCGCAGGATGATGAACAGCCACCTGCAGACGAGCCCGTGCCGTGCGATTGTTCCCGTGCGGAGGAGCGCCATGGGGTGGTGCCGTTGATTACGCTCGTAATCGTGCTCGCGTTCGCTCGTACCCATTTCTTCATCGCATTTCCACATCTCCGTTTTCACAACATCCGTTGA
Predicted protein sequences of Glyma16g34140
>Glyma16g34140.1   sequence type=predicted peptide   gene model=Glyma16g34140   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEKLRPAWAVKAIIVIVFTSILFRCVCGENHTVGGASGWDLGSNIQAWSSTTTFNVGDDLVFSYTAAHDVMEVNQLDYDTCKIANALATYDNGETVIHLSDAKTRYFVCGRMGHCQQGLKLQVQILAQSNNGTSNDQNQSPGGSPPSTSPPPPPPPPPPQDDEQPPADEPVPCDCSRAEERHGVVPLITLVIVLAFARTHFFIAFPHLRFHNIR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo