Glyma16g33421 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g33421): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g33421): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma16g33421

Feature Type:	gene_model
Chromosome:	Gm16
Start:	36342067
stop:	36342588
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g33421

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G72920	AT	Annotation by Michelle Graham. TAIR10: Toll-Interleukin-Resistance (TIR) domain family protein \| chr1:27437947-27438868 FORWARD LENGTH=275	SoyBase	E_val: 2.00E-37	ISS
GO:0006952	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response	SoyBase	N/A	ISS
GO:0007165	GO-bp	Annotation by Michelle Graham. GO Biological Process: signal transduction	SoyBase	N/A	ISS
GO:0009611	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to wounding	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
PTHR23155	Panther	LEUCINE-RICH REPEAT-CONTAINING PROTEIN	JGI		ISS
PTHR23155:SF300	Panther		JGI		ISS
PF01582	PFAM	TIR domain	JGI		ISS
UniRef100_D6PT09	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Rj2 protein n=1 Tax=Glycine max RepID=D6PT09_SOYBN	SoyBase	E_val: 1.00E-51	ISS
UniRef100_UPI000233E084	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233E084 related cluster n=1 Tax=unknown RepID=UPI000233E084	SoyBase	E_val: 5.00E-56	ISS

Expression Patterns of Glyma16g33421

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g33421 not represented in the dataset	Glyma16g33421 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma16g33421 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.16g209000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma16g33421

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g33421

Limit To All Plant Sequences

>Glyma16g33421.1   sequence type=CDS   gene model=Glyma16g33421   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGCAACAAGCATCATCATCATCATCATCTTCTTCTTTCATATCAAAATACAAGTATGATGTGTTTCTTAGTTTTCGTGGTGCAGATACCCGTTTTCGTTTTACGGGTAATCTATACAGTGCTTTGAGTCAAAGGGGAATCTTTACCTTCATTGATGATGAAGCTCTGCGAAAAGGCGAAGAGATCACACCTTCTCTTCGCAAAGCAATAAAAGAATCCAGGATTTCCATCATTGTTTTCTCCAAAAATTATGCATCTTCAACATTTTGTTTGGATGAACTTGTCCAAATCCTTGAGTGTAAAACAAAACAAAACATGTGGATTTTTCCGGTGTTCTACGAAATAGATCCATCAGATTTGCGGCATCAGAATGGGAGTTACAAAGAAGAGTTTGCAAAGCACGAAGGTGGAAGATTCAAAGATGATATTCTGAAGCTGCAAAAATGGAGGAAGCTAATTTGTCTGGTTCGCACTTCAAAATTGGGTAACACACCTCTCTCTTTCTTGGTTTCAGTTTAA

Predicted protein sequences of Glyma16g33421

Limit To All Plant Sequences

>Glyma16g33421.1   sequence type=predicted peptide   gene model=Glyma16g33421   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAQQASSSSSSSSFISKYKYDVFLSFRGADTRFRFTGNLYSALSQRGIFTFIDDEALRKGEEITPSLRKAIKESRISIIVFSKNYASSTFCLDELVQILECKTKQNMWIFPVFYEIDPSDLRHQNGSYKEEFAKHEGGRFKDDILKLQKWRKLICLVRTSKLGNTPLSFLVSV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain