Glyma16g32550 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma16g32550

Feature Type:	gene_model
Chromosome:	Gm16
Start:	35716377
stop:	35717742
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g32550

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G25420	AT	Annotation by Michelle Graham. TAIR10: 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein \| chr4:12990982-12992409 REVERSE LENGTH=377	SoyBase	E_val: 8.00E-161	ISS
GO:0009686	GO-bp	Annotation by Michelle Graham. GO Biological Process: gibberellin biosynthetic process	SoyBase	N/A	ISS
GO:0009688	GO-bp	Annotation by Michelle Graham. GO Biological Process: abscisic acid biosynthetic process	SoyBase	N/A	ISS
GO:0009737	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0009739	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus	SoyBase	N/A	ISS
GO:0009740	GO-bp	Annotation by Michelle Graham. GO Biological Process: gibberellic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009793	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy	SoyBase	N/A	ISS
GO:0009826	GO-bp	Annotation by Michelle Graham. GO Biological Process: unidimensional cell growth	SoyBase	N/A	ISS
GO:0009845	GO-bp	Annotation by Michelle Graham. GO Biological Process: seed germination	SoyBase	N/A	ISS
GO:0009908	GO-bp	Annotation by Michelle Graham. GO Biological Process: flower development	SoyBase	N/A	ISS
GO:0010162	GO-bp	Annotation by Michelle Graham. GO Biological Process: seed dormancy process	SoyBase	N/A	ISS
GO:0016114	GO-bp	Annotation by Michelle Graham. GO Biological Process: terpenoid biosynthetic process	SoyBase	N/A	ISS
GO:0048366	GO-bp	Annotation by Michelle Graham. GO Biological Process: leaf development	SoyBase	N/A	ISS
GO:0048575	GO-bp	Annotation by Michelle Graham. GO Biological Process: short-day photoperiodism, flowering	SoyBase	N/A	ISS
GO:0048608	GO-bp	Annotation by Michelle Graham. GO Biological Process: reproductive structure development	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005506	GO-mf	Annotation by Michelle Graham. GO Molecular Function: iron ion binding	SoyBase	N/A	ISS
GO:0016491	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity	SoyBase	N/A	ISS
GO:0016706	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors	SoyBase	N/A	ISS
GO:0045544	GO-mf	Annotation by Michelle Graham. GO Molecular Function: gibberellin 20-oxidase activity	SoyBase	N/A	ISS
KOG0143	KOG	Iron/ascorbate family oxidoreductases	JGI		ISS
PTHR10209	Panther	FE(II)/ ASCORBATE OXIDASE SUPERFAMILY	JGI		ISS
PTHR10209:SF55	Panther	OXIDOREDUCTASE, 2OG-FE(II) OXYGENASE FAMILY PROTEI	JGI		ISS
PF03171	PFAM	2OG-Fe(II) oxygenase superfamily	JGI		ISS
UniRef100_I1MQ51	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MQ51_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_O04280	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Gibberellin 20-oxidase n=1 Tax=Phaseolus vulgaris RepID=O04280_PHAVU	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma16g32550

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma16g32550

Paralog	Evidence	Comments
Glyma09g27490	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma16g32550 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.16g200800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma16g32550

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g32550

Limit To All Plant Sequences

>Glyma16g32550.2   sequence type=CDS   gene model=Glyma16g32550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCATAGAGTGCATAACAAATATACAATCTATGTCTCAACCACAAAAGCATCACCAAGACCACAAAGAAGATGAAGCACCATTGGTTTTTGATGCCTCACTTCTCAGGCACGAACTCAACCTACCAAAGCAGTTCATTTGGCCAGATGAGGAGAAGCCATGCATGAATGTGCCTGAACTTGCTGTCCCTCTCATTGACTTGGGAGGGTTTATCTCTGGTGACCCTGTTGCGACAATGGAGGCTGCAAGGATGGTTGGTGAGGCATGCCAAAAGCATGGTTTCTTTCTTGTGGTGAACCATGGGATTGATGCCAAGTTAATCTCTCATGCTCATAGCTACATGGATGACTTCTTTGAGATTCCCCTGTCTCAGAAACAGAGGGCGCAGAGAAAAACAGGGGAACACTGTGGTTATGCTAGTAGCTTCACGGGCAGGAGGGTTTACCAGGACTATTGTGATGCCATGAGTAATCTTTCTTTGGGGATAATGGAACTTTTGGGAATGAGTCTTGGAGTTGGTAAAGCATGTTTTAGTGAGTTCTTTGAAGAGAATAACTCAATAATGAGGCTCAATTACTATCCTCCTTGTCAAAAACCTGACCTCACTTTGGGCACTGGACCTCACTGTGACCCAACATCTTTGACCATTCTTCACCAAGACCAAGTGGGAGGCCTCCAAGTTTTTGTTGACAATGAGTGGCATTCCGTTAGCCCAAATTTCAATGCTTTTGTTGTCAACATAGGTGACACCTTCATGGCTCTTTCAAATGGGAGGTACAAGAGTTGCTTGCATAGGGCAGTGGTGAACAGTAGGACCACAAGAAAATCTCTTGCTTTCTTTTTGTGTCCAAAAGGTGATAAGGTAGTTAGTCCACCAAGTGAATTGGTGGATGATTTGACCCCAAGGGTCTACCCAGATTTTACATGGCCTATGCTGCTTGAGTTTACTCAGAAACATTATAGAGCTGACATCAAAACCCTTGAGGCATTCACCAACTGGCTTCTTCAACGGAAAACGAACTGA

Predicted protein sequences of Glyma16g32550

Limit To All Plant Sequences

>Glyma16g32550.2   sequence type=predicted peptide   gene model=Glyma16g32550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAIECITNIQSMSQPQKHHQDHKEDEAPLVFDASLLRHELNLPKQFIWPDEEKPCMNVPELAVPLIDLGGFISGDPVATMEAARMVGEACQKHGFFLVVNHGIDAKLISHAHSYMDDFFEIPLSQKQRAQRKTGEHCGYASSFTGRRVYQDYCDAMSNLSLGIMELLGMSLGVGKACFSEFFEENNSIMRLNYYPPCQKPDLTLGTGPHCDPTSLTILHQDQVGGLQVFVDNEWHSVSPNFNAFVVNIGDTFMALSNGRYKSCLHRAVVNSRTTRKSLAFFLCPKGDKVVSPPSELVDDLTPRVYPDFTWPMLLEFTQKHYRADIKTLEAFTNWLLQRKTN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain