Glyma16g32230 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma16g32230

Feature Type:	gene_model
Chromosome:	Gm16
Start:	35394552
stop:	35398580
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g32230

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G61060	AT	Annotation by Michelle Graham. TAIR10: phloem protein 2-A13 \| chr3:22603166-22604336 FORWARD LENGTH=290	SoyBase	E_val: 2.00E-125	ISS
GO:0006499	GO-bp	Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation	SoyBase	N/A	ISS
GO:0009611	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to wounding	SoyBase	N/A	ISS
GO:0009744	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus	SoyBase	N/A	ISS
GO:0009750	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0030246	GO-mf	Annotation by Michelle Graham. GO Molecular Function: carbohydrate binding	SoyBase	N/A	ISS
UniRef100_G7IAQ2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: F-box family protein n=1 Tax=Medicago truncatula RepID=G7IAQ2_MEDTR	SoyBase	E_val: 2.00E-150	ISS
UniRef100_I1MQ11	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MQ11_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma16g32230

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma16g32230

Paralog	Evidence	Comments
Glyma09g26940	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma16g32230 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.16g197800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma16g32230

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g32230

Limit To All Plant Sequences

>Glyma16g32230.1   sequence type=CDS   gene model=Glyma16g32230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGGGCCGGTGTTTCTACAACTGCAATAGAAAATGATGATGGGGGCACTTTTTCTTTGTCAACAAAGACTACCCTTGATGATATCCCTGAGAATTGCATCTCTTCAATGATGATGAGTTTTGATCCACAAGAGATTTGCACATTGGCAAGAGTGAATAAGGCCTTTCACAGAGCTTCCTCTGCTGACTTTGTGTGGGAATCAAAGTTGCCCCCAAGCTATAAATTCCTTCTAAATAAAGTACTTGGTGAACAAAATCTTGGTTCCATGACCAAGAAAGAGATCTATGCCAAACTGTGTAGACCAAATTTCTTTGATGGTGCCAACAAAGAAGTTTGGCTGGACAGAAGCAGAGGACAAGTTTGTATGTTCATTTCATCAAAATCCTTCAAGATTACAGGAATAGATGATAGAAGATATTGGAATAATATTCCAACTGAGGAATCCAGGTTCAAGAGTGTTGCATATCTTCAACAAATGTGGTGGGTTGAAGTAATAGGGGAGCTAGAGTTTGAGTTTCCAAAAGGGAACTATAGTGTATTTTTCAAGCTTCAATTGGGCAAGCCCTCAAAGAGATTGGGCCGGCGAGTGTGCAACCTTGATCAAGTGCATGGATGGGACATCAAGCCCGTTAGATTTCAACTATCTACATCGGACGGCCAGCGTTCACTCTCCCAGTGCTATTTGCGTGGGTCCGGAGAGTGGGCCCACTACCATGTTGGTGACTTTGCAATCGATAAGCCCAATGGGCCAACCAACATCAACTTCTCCTTGGCCCAAATTGATTGCACTCACACCAAAGGTGGTCTTTGCATAGATGGGGTAGTGATTTGCCCGAAGGAGTTCACAGAAAGATTGAAACAATTTTAG

Predicted protein sequences of Glyma16g32230

Limit To All Plant Sequences

>Glyma16g32230.1   sequence type=predicted peptide   gene model=Glyma16g32230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGAGVSTTAIENDDGGTFSLSTKTTLDDIPENCISSMMMSFDPQEICTLARVNKAFHRASSADFVWESKLPPSYKFLLNKVLGEQNLGSMTKKEIYAKLCRPNFFDGANKEVWLDRSRGQVCMFISSKSFKITGIDDRRYWNNIPTEESRFKSVAYLQQMWWVEVIGELEFEFPKGNYSVFFKLQLGKPSKRLGRRVCNLDQVHGWDIKPVRFQLSTSDGQRSLSQCYLRGSGEWAHYHVGDFAIDKPNGPTNINFSLAQIDCTHTKGGLCIDGVVICPKEFTERLKQF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain