Glyma16g31780 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma16g31780

Feature Type:	gene_model
Chromosome:	Gm16
Start:	35065425
stop:	35065778
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g31780

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G44300	AT	Annotation by Michelle Graham. TAIR10: Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein \| chr2:18307468-18308286 REVERSE LENGTH=204	SoyBase	E_val: 1.00E-30	ISS
GO:0006869	GO-bp	Annotation by Michelle Graham. GO Biological Process: lipid transport	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0031225	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane	SoyBase	N/A	ISS
GO:0008289	GO-mf	Annotation by Michelle Graham. GO Molecular Function: lipid binding	SoyBase	N/A	ISS
PF00234	PFAM	Protease inhibitor/seed storage/LTP family	JGI		ISS
UniRef100_B9REN2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Lipid binding protein, putative n=1 Tax=Ricinus communis RepID=B9REN2_RICCO	SoyBase	E_val: 4.00E-34	ISS
UniRef100_UPI000233EC02	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233EC02 related cluster n=1 Tax=unknown RepID=UPI000233EC02	SoyBase	E_val: 2.00E-73	ISS

Expression Patterns of Glyma16g31780

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma16g31780 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.16g193400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma16g31780

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g31780

Limit To All Plant Sequences

>Glyma16g31780.2   sequence type=CDS   gene model=Glyma16g31780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATTCAAATGCTTGTCTACCACACTTGCTAGTGTTAGCAATAACATTGGTATTGGTTAGTCATGCAATGGGAGATTCAGCTCAAGACAAACAGAGATGTGCAGAATCCCTGACAGGTGTTGCAACGTGTCTGCCATATTTGGGTGCTGACGCAAAAGCACCCACAGCAGATTGTTGCAGTGGTCTCACACAAGCCATGAAGGCCAACAAGAAGTGTGTCTGCCTTATTCTCAAAGACAGGGATGATCCTGACCTTGGCTTAAATATTAACATGACAATTGCTGTTGGTCTCCCTTCTCTTTGCAAAACACCTGATAATCTCTCACAGTGTTCTGGTACGTTCAATTTCTAA

Predicted protein sequences of Glyma16g31780

Limit To All Plant Sequences

>Glyma16g31780.2   sequence type=predicted peptide   gene model=Glyma16g31780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDSNACLPHLLVLAITLVLVSHAMGDSAQDKQRCAESLTGVATCLPYLGADAKAPTADCCSGLTQAMKANKKCVCLILKDRDDPDLGLNINMTIAVGLPSLCKTPDNLSQCSGTFNF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain