Glyma16g31736 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g31736): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g31736): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma16g31736

Feature Type:	gene_model
Chromosome:	Gm16
Start:	35044545
stop:	35045905
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g31736

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G48900	AT	Annotation by Michelle Graham. TAIR10: single-stranded DNA endonuclease family protein \| chr3:18132449-18136239 FORWARD LENGTH=536	SoyBase	E_val: 4.00E-37	ISS
GO:0006281	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA repair	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0004518	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nuclease activity	SoyBase	N/A	ISS
PTHR11081	Panther	XP-G/RAD2 DNA REPAIR ENDONUCLEASE FAMILY	JGI		ISS
PTHR11081:SF22	Panther	SUBFAMILY NOT NAMED	JGI		ISS
UniRef100_G7KLZ3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Flap endonuclease GEN-like protein n=1 Tax=Medicago truncatula RepID=G7KLZ3_MEDTR	SoyBase	E_val: 1.00E-61	ISS
UniRef100_UPI000233EBFF	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233EBFF related cluster n=1 Tax=unknown RepID=UPI000233EBFF	SoyBase	E_val: 1.00E-99	ISS

Expression Patterns of Glyma16g31736

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g31736 not represented in the dataset	Glyma16g31736 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma16g31736 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma16g31736

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g31736

Limit To All Plant Sequences

>Glyma16g31736.1   sequence type=CDS   gene model=Glyma16g31736   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GGTAAGAATGATTTACGGCCGGATGATAACATTTTACAAGTAATTAATGCTTATATGAACACAAAATGTCACCAAGCAGATTCAGATATTGTGCACAAAAATTTACGACGATTTGCCAATTTGCGTTTAACTTCATCTGAAGTTGGACTGAACCTTCCTTTACATGAGATCCCTGTGAAGTGTCCTGTGTCAGAAATCATTAAGAGCCGAAGAGTTCAAGGGAGAGAATGCTACGAGGTTTCTTGGGAAGGAATGGATGGACTTGAAACTTCAATAGTACCTGCAGATCTTATAGAAAGTGCTTGTCGTGAGAAGATTTTGGAGTTCGAGGAAAGAAAAGCTCAACGGAAGAAACAAAATATTCAGAAAAGAAAACCAAAGAAAAAGGAAACTAATTCATCTGTGGCAGAGCTTGATCTAAAACTTCAGAATTTGTTGCTTGATATTAATTTAAGAGACGAAGCCAACTTCAATGCCTCTGATTCTTGA

Predicted protein sequences of Glyma16g31736

Limit To All Plant Sequences

>Glyma16g31736.1   sequence type=predicted peptide   gene model=Glyma16g31736   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GKNDLRPDDNILQVINAYMNTKCHQADSDIVHKNLRRFANLRLTSSEVGLNLPLHEIPVKCPVSEIIKSRRVQGRECYEVSWEGMDGLETSIVPADLIESACREKILEFEERKAQRKKQNIQKRKPKKKETNSSVAELDLKLQNLLLDINLRDEANFNASDS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain