Glyma16g29790 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma16g29790

Feature Type:	gene_model
Chromosome:	Gm16
Start:	33472525
stop:	33475361
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g29790

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G25700	AT	Annotation by Michelle Graham. TAIR10: beta-hydroxylase 1 \| chr4:13094142-13095866 REVERSE LENGTH=310	SoyBase	E_val: 1.00E-149	ISS
GO:0006633	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid biosynthetic process	SoyBase	N/A	ISS
GO:0016119	GO-bp	Annotation by Michelle Graham. GO Biological Process: carotene metabolic process	SoyBase	N/A	ISS
GO:0016123	GO-bp	Annotation by Michelle Graham. GO Biological Process: xanthophyll biosynthetic process	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0005506	GO-mf	Annotation by Michelle Graham. GO Molecular Function: iron ion binding	SoyBase	N/A	ISS
GO:0010291	GO-mf	Annotation by Michelle Graham. GO Molecular Function: carotene beta-ring hydroxylase activity	SoyBase	N/A	ISS
GO:0016491	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity	SoyBase	N/A	ISS
PF04116	PFAM	Fatty acid hydroxylase superfamily	JGI		ISS
UniRef100_C6T7G0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T7G0_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_G4Y9K1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Beta-carotene hydroxylase 5 n=1 Tax=Glycine max RepID=G4Y9K1_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma16g29790

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma16g29790

Paralog	Evidence	Comments
Glyma09g24530	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma16g29790 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.16g179100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma16g29790

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g29790

Limit To All Plant Sequences

>Glyma16g29790.1   sequence type=CDS   gene model=Glyma16g29790   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGGTAGGACTCTCCGCCGCCATAACCATGAAGTCCCTCCTCCGTTTCCACCAACCTCACCTGAACCTCCCCAAATCAATCCCAACAACACTCCCTTTCTCCCCCATGAGAATTTTCCACCACACAGCATCACCAAGAACCCAAAAAGTTTCAACTTTCACCGTTTGTGTCCTCATGCAGGACCCAAAACAAGGCACCCACATGGAAATTGAGCCACAAGAACAACCTCCTCCTCCTCCTCCTCCTCCCGCTCAACAAGTTCTGTCACCAAAGTTGGCTGAGAAATTGGCCAGAAAAGAGTCTGAGAGGTTCACTTACCTTGTTGCTGCTGTCATGTCTAGCTTCGGCATCACATCCATGGCAGTGTTCGCTGTTTATTGCAGATTCTCGTGGCAAATGGAGGGTGGAGAAGTGCCTTGGTCTGAAATGTTTGGCACATTTGCTCTATCAGTGGGAGCTGCTGTGGGTATGGAATTTTGGGCTAGATGGGCTCATAGGGCTCTCTGGCATGCTTCGCTGTGGCACATGCATGAGTCCCACCATCGACCAAGAGAAGGACCCTTCGAGCTTAACGATGTATTTGCAATAATCAACGCTGTCCCTGCCATCGCTCTCCTTTCCTATGGTTTCTTTAACAAGGGACTGGTCCCTGGCCTTTGCTTTGGTGCGGGTCTTGGAATTACGGTCTTTGGGATGGCCTACATGTTTGTACACGATGGATTGGTTCATAAGAGATTCCCGGTGGGCCCCATTGCAAACGTGCCCTATCTCAGAAGGGTGGCCTCTGCTCACCAACTTCACCATTCGGAAAAATTCAATGGAGTGCCATATGGGCTGTTTTTGGGACCCAAGGAAATTGAAGAGGTGGGAGGGCTAGAAGAGCTGGAGAAAGAGATAAGTAGGAGAGCAAGATCATACAAAATAGCTAATGAGAACAACTAA

Predicted protein sequences of Glyma16g29790

Limit To All Plant Sequences

>Glyma16g29790.1   sequence type=predicted peptide   gene model=Glyma16g29790   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAVGLSAAITMKSLLRFHQPHLNLPKSIPTTLPFSPMRIFHHTASPRTQKVSTFTVCVLMQDPKQGTHMEIEPQEQPPPPPPPPAQQVLSPKLAEKLARKESERFTYLVAAVMSSFGITSMAVFAVYCRFSWQMEGGEVPWSEMFGTFALSVGAAVGMEFWARWAHRALWHASLWHMHESHHRPREGPFELNDVFAIINAVPAIALLSYGFFNKGLVPGLCFGAGLGITVFGMAYMFVHDGLVHKRFPVGPIANVPYLRRVASAHQLHHSEKFNGVPYGLFLGPKEIEEVGGLEELEKEISRRARSYKIANENN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain