|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G01900 | AT | Annotation by Michelle Graham. TAIR10: GLNB1 homolog | chr4:821736-823294 FORWARD LENGTH=196 | SoyBase | E_val: 3.00E-24 | ISS |
| GO:0000096 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sulfur amino acid metabolic process | SoyBase | N/A | ISS |
| GO:0006546 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glycine catabolic process | SoyBase | N/A | ISS |
| GO:0006636 | GO-bp | Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process | SoyBase | N/A | ISS |
| GO:0006733 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxidoreduction coenzyme metabolic process | SoyBase | N/A | ISS |
| GO:0006766 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vitamin metabolic process | SoyBase | N/A | ISS |
| GO:0006807 | GO-bp | Annotation by Michelle Graham. GO Biological Process: nitrogen compound metabolic process | SoyBase | N/A | ISS |
| GO:0006808 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of nitrogen utilization | SoyBase | N/A | ISS |
| GO:0006816 | GO-bp | Annotation by Michelle Graham. GO Biological Process: calcium ion transport | SoyBase | N/A | ISS |
| GO:0007030 | GO-bp | Annotation by Michelle Graham. GO Biological Process: Golgi organization | SoyBase | N/A | ISS |
| GO:0008652 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular amino acid biosynthetic process | SoyBase | N/A | ISS |
| GO:0009072 | GO-bp | Annotation by Michelle Graham. GO Biological Process: aromatic amino acid family metabolic process | SoyBase | N/A | ISS |
| GO:0009106 | GO-bp | Annotation by Michelle Graham. GO Biological Process: lipoate metabolic process | SoyBase | N/A | ISS |
| GO:0009108 | GO-bp | Annotation by Michelle Graham. GO Biological Process: coenzyme biosynthetic process | SoyBase | N/A | ISS |
| GO:0009117 | GO-bp | Annotation by Michelle Graham. GO Biological Process: nucleotide metabolic process | SoyBase | N/A | ISS |
| GO:0009409 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cold | SoyBase | N/A | ISS |
| GO:0009416 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to light stimulus | SoyBase | N/A | ISS |
| GO:0009651 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to salt stress | SoyBase | N/A | ISS |
| GO:0009695 | GO-bp | Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process | SoyBase | N/A | ISS |
| GO:0009718 | GO-bp | Annotation by Michelle Graham. GO Biological Process: anthocyanin-containing compound biosynthetic process | SoyBase | N/A | ISS |
| GO:0009744 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus | SoyBase | N/A | ISS |
| GO:0009749 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to glucose stimulus | SoyBase | N/A | ISS |
| GO:0009750 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus | SoyBase | N/A | ISS |
| GO:0019288 | GO-bp | Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway | SoyBase | N/A | ISS |
| GO:0019748 | GO-bp | Annotation by Michelle Graham. GO Biological Process: secondary metabolic process | SoyBase | N/A | ISS |
| GO:0042304 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of fatty acid biosynthetic process | SoyBase | N/A | ISS |
| GO:0044272 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sulfur compound biosynthetic process | SoyBase | N/A | ISS |
| GO:2000013 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of arginine biosynthetic process via ornithine | SoyBase | N/A | ISS |
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0009534 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid | SoyBase | N/A | ISS |
| GO:0009536 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plastid | SoyBase | N/A | ISS |
| GO:0000287 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: magnesium ion binding | SoyBase | N/A | ISS |
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
| GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
| GO:0010307 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: acetylglutamate kinase regulator activity | SoyBase | N/A | ISS |
| GO:0030234 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: enzyme regulator activity | SoyBase | N/A | ISS |
| PF00543 | PFAM | Nitrogen regulatory protein P-II | JGI | ISS | |
| UniRef100_I1NBG0 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NBG0_SOYBN | SoyBase | E_val: 3.00E-26 | ISS |
| UniRef100_Q9ARI4 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: PII protein n=1 Tax=Medicago sativa RepID=Q9ARI4_MEDSA | SoyBase | E_val: 7.00E-24 | ISS |
|
Glyma16g28422 not represented in the dataset |
Glyma16g28422 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.16g168800 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma16g28422.1 sequence type=CDS gene model=Glyma16g28422 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCTGATACTAAATTTTAGTTTTCTTGATTCGAAGGTTTTGTTGAAAATGGGAATTCGTGGTGTCACTGTATCTGATGTCAGGGGCTTTGGTGCTCAGGGTGGTTCAAAAGAGAGGCAGGGAAGCTCCGAATTTCCAGAAGACAATTTTGTTGCCAAAGTTAAAATGGAAGTAGTGGTGAGAAAGGACCAGGTAAGGTAG
>Glyma16g28422.1 sequence type=predicted peptide gene model=Glyma16g28422 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MLILNFSFLDSKVLLKMGIRGVTVSDVRGFGAQGGSKERQGSSEFPEDNFVAKVKMEVVVRKDQVR*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||