Glyma16g27390 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma16g27390

Feature Type:	gene_model
Chromosome:	Gm16
Start:	31455895
stop:	31456756
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g27390

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G34300	AT	Annotation by Michelle Graham. TAIR10: lectin protein kinase family protein \| chr1:12503450-12505939 FORWARD LENGTH=829	SoyBase	E_val: 3.00E-23	ISS
GO:0006468	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein phosphorylation	SoyBase	N/A	ISS
GO:0006487	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein N-linked glycosylation	SoyBase	N/A	ISS
GO:0048544	GO-bp	Annotation by Michelle Graham. GO Biological Process: recognition of pollen	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0004672	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein kinase activity	SoyBase	N/A	ISS
GO:0004674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016301	GO-mf	Annotation by Michelle Graham. GO Molecular Function: kinase activity	SoyBase	N/A	ISS
GO:0016772	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups	SoyBase	N/A	ISS
GO:0030246	GO-mf	Annotation by Michelle Graham. GO Molecular Function: carbohydrate binding	SoyBase	N/A	ISS
PF01453	PFAM	D-mannose binding lectin	JGI		ISS
UniRef100_B9RW31	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1, putative n=1 Tax=Ricinus communis RepID=B9RW31_RICCO	SoyBase	E_val: 2.00E-30	ISS
UniRef100_I1NH90	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1NH90_SOYBN	SoyBase	E_val: 3.00E-38	ISS

Expression Patterns of Glyma16g27390

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma16g27390 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.16g157500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma16g27390

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g27390

Limit To All Plant Sequences

>Glyma16g27390.1   sequence type=CDS   gene model=Glyma16g27390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCAATATTCCATTCCATATCCCTTCTACCAAGCAATACCTTATTTAAGAGTCAGTTCCTTCCATTGTTACACATGCAAAACAAGAAACACAAACCAAGTACTAAAATCACAATGCTCAAAATAAAAGATTTGCTACTTTCTCTTACCCTTTTCATCATTTCAGTTGTGGCCATCTCACCAGGTTCAACCCTTTATGCTTCAAACACTAACCAAGCATGGTCATCCCCCAACAACACATTCTCTCTTAATTTTCTTCAAGTCCAACCCCCAATTTCTCCTCCTTCCTTCATGGTTGGTATTGTCCACTCTGGAGGTGTAGGTGGTGGAACTTTAGTAGACTCAAGAGGTTCATTCCAATTGCTCTCAATTGGAAGTTTGCAACTTGTTGATGGATCTGGTGCCATATTATGGAACTCAGGAACTTCCCATTTTTGTGTCTTCTCTACCTTCCTTGATGAGCAAGGCAACTTTGTTCTTTCCAATGGAACTAGCACTGTGTGGTCCAGTTTTGATCACCCCACAGATACACCATTGTGCCACCTCAGATTTTCACTCCTAACATGA

Predicted protein sequences of Glyma16g27390

Limit To All Plant Sequences

>Glyma16g27390.1   sequence type=predicted peptide   gene model=Glyma16g27390   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPIFHSISLLPSNTLFKSQFLPLLHMQNKKHKPSTKITMLKIKDLLLSLTLFIISVVAISPGSTLYASNTNQAWSSPNNTFSLNFLQVQPPISPPSFMVGIVHSGGVGGGTLVDSRGSFQLLSIGSLQLVDGSGAILWNSGTSHFCVFSTFLDEQGNFVLSNGTSTVWSSFDHPTDTPLCHLRFSLLT*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain