Glyma16g26710 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g26710): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g26710): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma16g26710

Feature Type:	gene_model
Chromosome:	Gm16
Start:	30804752
stop:	30807083
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g26710

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G08560	AT	Annotation by Michelle Graham. TAIR10: syntaxin of plants 111 \| chr1:2709778-2710710 REVERSE LENGTH=310	SoyBase	E_val: 1.00E-131	ISS
GO:0000226	GO-bp	Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization	SoyBase	N/A	ISS
GO:0000910	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytokinesis	SoyBase	N/A	ISS
GO:0000911	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation	SoyBase	N/A	ISS
GO:0006084	GO-bp	Annotation by Michelle Graham. GO Biological Process: acetyl-CoA metabolic process	SoyBase	N/A	ISS
GO:0006886	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular protein transport	SoyBase	N/A	ISS
GO:0008283	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell proliferation	SoyBase	N/A	ISS
GO:0010583	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone	SoyBase	N/A	ISS
GO:0016126	GO-bp	Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process	SoyBase	N/A	ISS
GO:0016192	GO-bp	Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport	SoyBase	N/A	ISS
GO:0051225	GO-bp	Annotation by Michelle Graham. GO Biological Process: spindle assembly	SoyBase	N/A	ISS
GO:0051322	GO-bp	Annotation by Michelle Graham. GO Biological Process: anaphase	SoyBase	N/A	ISS
GO:0051329	GO-bp	Annotation by Michelle Graham. GO Biological Process: interphase of mitotic cell cycle	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009504	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell plate	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0009524	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: phragmoplast	SoyBase	N/A	ISS
GO:0012505	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endomembrane system	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0005484	GO-mf	Annotation by Michelle Graham. GO Molecular Function: SNAP receptor activity	SoyBase	N/A	ISS
KOG0810	KOG	SNARE protein Syntaxin 1 and related proteins	JGI		ISS
PTHR19957	Panther	SYNTAXIN	JGI		ISS
PTHR19957:SF26	Panther	SYNTAXIN, ARABIDOPSIS THALIANA	JGI		ISS
PF00804	PFAM	Syntaxin	JGI		ISS
PF05739	PFAM	SNARE domain	JGI		ISS
UniRef100_G7KG89	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Knolle n=1 Tax=Medicago truncatula RepID=G7KG89_MEDTR	SoyBase	E_val: 2.00E-180	ISS
UniRef100_I1MNS3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MNS3_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma16g26710

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g26710 not represented in the dataset	Glyma16g26710 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma16g26710

Paralog	Evidence	Comments
Glyma02g07670	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma16g26710 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.16g151200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma16g26710

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g26710

Limit To All Plant Sequences

>Glyma16g26710.1   sequence type=CDS   gene model=Glyma16g26710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACGATCTTATGACCAAATCCTTCACCAGCTACGTGGACCTGAAGAAGGCTGCAATGAAAGAAGATGTTGATTTGGAAGCTGGTGTTGTTGTTTCTTCTGCTACTCCTCGCAACGTGGAACTTACCTCTTCCACAACACACTTGGACACCGACATGGGTCTCTTCCTCGAAGAGGCTGAGAAGGTGAAGGCTGAGATGGGGTCCCTCCGTGACATCCTCGGCCGCCTCCAGCAGGCCAACGAGGAGAGCAAGTCCTTGCACAAGCCCGAGGCCCTCAAGGTGCTCCGGGCCCGGATCAATGCGGACATTGTCGCTGTGCTCAAGAAGGCCCGGGCGATCCGGGCCCAGCTAGAGGAGATGGACCGCGCCAATGCTGCCAACAGGCGCCTCTCCGGCCTCAAGGAGGGGACGCCCGCGATCTACCGGACCCGGATTGCAGTCACCAATGGGCTCAGGAAGAAGCTGAAAGAGCTCATGATGGAGTTTCAGGGGCTGAGGCAGAGGATGATGAGTGAGTACAAGGATACTGTGGGGAGAAGGTACTTCACAGTGACTGGGGAGCACCCAGATGAGGAAGTGATTGAGAAGATCATCGCCAACGGGAACGAGGAAGAGGTTCTGGGGAAGGCCATACAGGAACACGGGAGAGGGAAGGTTCTGGAAACAGTGGTTGAGATTCAGGACAGGCATGATGCTGCCAAGGAGGTGGAGAAGAGTCTACTGGAGCTGCACCAGGTGTTTCTTGACATGGCTGTGATGGTGGAGGCACAGGGTGAGAAGATGGATGACATTGAGCATCACGTGCTGCATGCTTCTCACTATGTCAAGGATGGGACCAAGAATCTCCAGAGTGCAAAGGAGTACCAGAAGAAGAGCAGGAAGTGGATGTGCATTGGGATCATTCTGTTGCTCATTCTTATTCTGTTTATTGTTATTCCTGTTGTCACCAGTTTAAGCAGTTCTTGA

Predicted protein sequences of Glyma16g26710

Limit To All Plant Sequences

>Glyma16g26710.1   sequence type=predicted peptide   gene model=Glyma16g26710   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNDLMTKSFTSYVDLKKAAMKEDVDLEAGVVVSSATPRNVELTSSTTHLDTDMGLFLEEAEKVKAEMGSLRDILGRLQQANEESKSLHKPEALKVLRARINADIVAVLKKARAIRAQLEEMDRANAANRRLSGLKEGTPAIYRTRIAVTNGLRKKLKELMMEFQGLRQRMMSEYKDTVGRRYFTVTGEHPDEEVIEKIIANGNEEEVLGKAIQEHGRGKVLETVVEIQDRHDAAKEVEKSLLELHQVFLDMAVMVEAQGEKMDDIEHHVLHASHYVKDGTKNLQSAKEYQKKSRKWMCIGIILLLILILFIVIPVVTSLSSS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain