SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g26690): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g26690): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma16g26690

Feature Type:gene_model
Chromosome:Gm16
Start:30780496
stop:30783509
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G65480AT Annotation by Michelle Graham. TAIR10: PEBP (phosphatidylethanolamine-binding protein) family protein | chr1:24331510-24333689 FORWARD LENGTH=175 SoyBaseE_val: 6.00E-94ISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0009911GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of flower development SoyBaseN/AISS
GO:0010119GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of stomatal movement SoyBaseN/AISS
GO:0048573GO-bp Annotation by Michelle Graham. GO Biological Process: photoperiodism, flowering SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0008429GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphatidylethanolamine binding SoyBaseN/AISS
KOG3346 KOG Phosphatidylethanolamine binding protein JGI ISS
PTHR11362Panther PHOSPHATIDYLETHANOLAMINE-BINDING PROTEIN JGI ISS
PF01161PFAM Phosphatidylethanolamine-binding protein JGI ISS
UniRef100_G7Z0A5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Flowering locus T-like protein 5 n=1 Tax=Glycine max RepID=G7Z0A5_SOYBN SoyBaseE_val: 1.00E-126ISS
UniRef100_G7Z0A5UniRef Annotation by Michelle Graham. Best UniRef hit: Flowering locus T-like protein 5 n=1 Tax=Glycine max RepID=G7Z0A5_SOYBN SoyBaseE_val: 1.00E-126ISS

LocusGene SymbolProtein Name
FT2b Flowering locus T gene 2b
FTL5 Flowering locus T-like gene 5
FT2b Flowering Locus T 2 gene b

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g26690 not represented in the dataset

Glyma16g26690 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.16g151000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma16g26690.1   sequence type=CDS   gene model=Glyma16g26690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCTCGTGGAAGTAGGGACCCTCTAGTTGTTGGGCGTGTGATTGGGGATGTATTGGACCCTTTTGAATGTTCTATTCCTATGAGGGTCACCTACAATAACAAAGATGTCAGCAATGGATGTGAATTCAAACCCTCACAAGTTGTCAACCAACCAAGAATAAATATCGGTGGTGATGATTTCAGGAACTTCTACACTTTGATCGCGGTTGATCCTGATGCACCTAGCCCAAGTGATCCCAATTTCAGAGAATACCTCCATTGGTTAGTAACTGACATTCCAGCAACAACGGGGCCTACTTTCGGTCATGAGGTTGTAACATATGAAAATCCACGACCCATGATGGGGATCCATCGTATAGTCTTTGTGTTATTTCGTCAACAGGGTAGAGAGACAGTGTATGCACCAGGATGGCGCCAAAATTTCATTACTAGAGAATTTGCTGAACTTTACAATCTTGGATTGCCAGTTGCTGCTGTCTATTTTAACATCCAGAGAGAATCTGGTTGTGGTGGAAGAAGGCTATGTTAA

>Glyma16g26690.1   sequence type=predicted peptide   gene model=Glyma16g26690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPRGSRDPLVVGRVIGDVLDPFECSIPMRVTYNNKDVSNGCEFKPSQVVNQPRINIGGDDFRNFYTLIAVDPDAPSPSDPNFREYLHWLVTDIPATTGPTFGHEVVTYENPRPMMGIHRIVFVLFRQQGRETVYAPGWRQNFITREFAELYNLGLPVAAVYFNIQRESGCGGRRLC*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo