Glyma16g26660 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma16g26660

Feature Type:	gene_model
Chromosome:	Gm16
Start:	30741660
stop:	30746677
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g26660

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G65480	AT	Annotation by Michelle Graham. TAIR10: PEBP (phosphatidylethanolamine-binding protein) family protein \| chr1:24331510-24333689 FORWARD LENGTH=175	SoyBase	E_val: 6.00E-95	ISS
GO:0009909	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of flower development	SoyBase	N/A	ISS
GO:0009911	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of flower development	SoyBase	N/A	ISS
GO:0010119	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of stomatal movement	SoyBase	N/A	ISS
GO:0048573	GO-bp	Annotation by Michelle Graham. GO Biological Process: photoperiodism, flowering	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0008429	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphatidylethanolamine binding	SoyBase	N/A	ISS
KOG3346	KOG	Phosphatidylethanolamine binding protein	JGI		ISS
PTHR11362	Panther	PHOSPHATIDYLETHANOLAMINE-BINDING PROTEIN	JGI		ISS
PF01161	PFAM	Phosphatidylethanolamine-binding protein	JGI		ISS
UniRef100_E3NYP3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: FT-like protein n=2 Tax=Glycine max RepID=E3NYP3_SOYBN	SoyBase	E_val: 1.00E-125	ISS
UniRef100_E3NYP3	UniRef	Annotation by Michelle Graham. Best UniRef hit: FT-like protein n=2 Tax=Glycine max RepID=E3NYP3_SOYBN	SoyBase	E_val: 1.00E-125	ISS

Proteins Associated with Glyma16g26660

Locus	Gene Symbol	Protein Name
	FT2a	Flowering locus T gene 2a
	FTL3	Flowering locus T-like gene 3
	FT2a	Flowering Locus T 2 gene a
	FT2a	Flowering Locus T2 gene a

Expression Patterns of Glyma16g26660

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma16g26660

Paralog	Evidence	Comments
Glyma02g07650	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma16g26660 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.16g150700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma16g26660

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g26660

Limit To All Plant Sequences

>Glyma16g26660.1   sequence type=CDS   gene model=Glyma16g26660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCTAGTGGAAGTAGGGATCCTCTCGTTGTTGGGGGAGTAATTGGGGATGTATTGGATCCTTTTGAATATTCTATTCCTATGAGGGTTACCTACAATAACAGAGATGTCAGCAATGGATGTGAATTCAAACCCTCACAAGTTGTCAACCAACCAAGGGTAAATATCGGTGGTGATGACCTCAGGAACTTCTATACTTTGATTGCGGTTGATCCCGATGCACCTAGCCCAAGTGACCCCAATTTGAGAGAATACCTCCATTGGTTGGTGACTGATATCCCAGCAACAACAGGGGCTAGTTTCGGCCATGAGGTTGTAACATATGAAAGTCCAAGACCAATGATGGGGATTCATCGTTTGGTGTTTGTGTTATTTCGTCAACTGGGTAGGGAGACCGTGTATGCACCAGGATGGCGCCAGAATTTCAACACTAAAGAATTTGCTGAACTTTACAACCTTGGATTGCCAGTTGCTGCTGTCTATTTCAACATTCAGAGGGAATCTGGTTCTGGTGGAAGGAGGTTATACTAA

Predicted protein sequences of Glyma16g26660

Limit To All Plant Sequences

>Glyma16g26660.1   sequence type=predicted peptide   gene model=Glyma16g26660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPSGSRDPLVVGGVIGDVLDPFEYSIPMRVTYNNRDVSNGCEFKPSQVVNQPRVNIGGDDLRNFYTLIAVDPDAPSPSDPNLREYLHWLVTDIPATTGASFGHEVVTYESPRPMMGIHRLVFVLFRQLGRETVYAPGWRQNFNTKEFAELYNLGLPVAAVYFNIQRESGSGGRRLY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain