Glyma16g26291 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g26291): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g26291): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma16g26291

Feature Type:	gene_model
Chromosome:	Gm16
Start:	30422873
stop:	30426601
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g26291

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G26744	AT	Annotation by Michelle Graham. TAIR10: basic helix-loop-helix (bHLH) DNA-binding superfamily protein \| chr3:9832953-9834790 REVERSE LENGTH=494	SoyBase	E_val: 1.00E-103	ISS
GO:0000085	GO-bp	Annotation by Michelle Graham. GO Biological Process: G2 phase of mitotic cell cycle	SoyBase	N/A	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009409	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cold	SoyBase	N/A	ISS
GO:0009410	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to xenobiotic stimulus	SoyBase	N/A	ISS
GO:0009640	GO-bp	Annotation by Michelle Graham. GO Biological Process: photomorphogenesis	SoyBase	N/A	ISS
GO:0009793	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy	SoyBase	N/A	ISS
GO:0009845	GO-bp	Annotation by Michelle Graham. GO Biological Process: seed germination	SoyBase	N/A	ISS
GO:0009909	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of flower development	SoyBase	N/A	ISS
GO:0009933	GO-bp	Annotation by Michelle Graham. GO Biological Process: meristem structural organization	SoyBase	N/A	ISS
GO:0010162	GO-bp	Annotation by Michelle Graham. GO Biological Process: seed dormancy process	SoyBase	N/A	ISS
GO:0010182	GO-bp	Annotation by Michelle Graham. GO Biological Process: sugar mediated signaling pathway	SoyBase	N/A	ISS
GO:0010228	GO-bp	Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem	SoyBase	N/A	ISS
GO:0010440	GO-bp	Annotation by Michelle Graham. GO Biological Process: stomatal lineage progression	SoyBase	N/A	ISS
GO:0016567	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein ubiquitination	SoyBase	N/A	ISS
GO:0016571	GO-bp	Annotation by Michelle Graham. GO Biological Process: histone methylation	SoyBase	N/A	ISS
GO:0016579	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein deubiquitination	SoyBase	N/A	ISS
GO:0019915	GO-bp	Annotation by Michelle Graham. GO Biological Process: lipid storage	SoyBase	N/A	ISS
GO:0043687	GO-bp	Annotation by Michelle Graham. GO Biological Process: post-translational protein modification	SoyBase	N/A	ISS
GO:0045893	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0048522	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of cellular process	SoyBase	N/A	ISS
GO:0050826	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to freezing	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
PTHR12565	Panther	STEROL REGULATORY ELEMENT-BINDING PROTEIN	JGI		ISS
PTHR12565:SF7	Panther	CENTROMERE-BINDING PROTEIN 1, CBP-1	JGI		ISS
PF00010	PFAM	Helix-loop-helix DNA-binding domain	JGI		ISS
UniRef100_E7CZZ6	UniRef	Annotation by Michelle Graham. Best UniRef hit: ICEe n=1 Tax=Glycine max RepID=E7CZZ6_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_E7CZZ6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: ICEe n=1 Tax=Glycine max RepID=E7CZZ6_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma16g26291

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g26291 not represented in the dataset	Glyma16g26291 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma16g26291 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.16g147200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma16g26291

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g26291

Limit To All Plant Sequences

>Glyma16g26291.1   sequence type=CDS   gene model=Glyma16g26291   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCGCCACCGCCGCCACCGCAGTTGGCGATGGAGAAGAGGAGGAAGAGGGGTGAGGAGGGGGAGGATGAGGGAGGGTTGAATTATGAGTCTGGTGAGGATATGAAGTTGGAGGAGAATGGTGTTGATGCAAATAACAATGATAATGATAATGATGATGATGATGATGATGGTGATGGTGATAATGGGAATGGGAATGGTGGTGGTGGTGGTGGAGACCAGAAGGGGAAGAAGAAGAAGAGGAAGAAGATGCCGGCGAAGAATCTCATGGCGGAGAGGAGGCGGAGGAAGAAGCTCAATGATAAGTTGTACATGTTAAGGTCTGTTGTGCCTAATATTAGCAAGATGGATAGGGCCTCAATACTAGGGGATGCCATTGACTACTTAAGGGAGTTACAAGTGCGAATTACTGATCTTAATCATGAACTAGAGTCAGGCCCGCCTGGCTCATCCCTTCCACCTGCTGCAAGCTTTCACCCTGTGACACCCACTCTGCCTACCCTTCCCTGCCGGGTGAAGGAAGAAATATGTCCTATCTCTCTGCCAAGTCCTAAAAACCAATCAGCAAAGGTGGAGGTTACGGTAAGGGAAGGGGGAGCTGTCAATATCCATATGTTTTGTGCCCACAGACCAGGTCTTTTACTTTCTACCATGAGGGCAATGGATAGCCTTGGATTGGATGTTCAGCAGGCCGTAATCAGTTGTTTCAATGGTTTTTCTTTAGATGTGTTTAGAGCTGAGCAATGCCGAGAAGGCCAGGATGTCCTTCCAGAGCAAATTAAAGAAGTATTGTTGGACACAGCAGGTTTCCATGGAATGATGTGA

Predicted protein sequences of Glyma16g26291

Limit To All Plant Sequences

>Glyma16g26291.1   sequence type=predicted peptide   gene model=Glyma16g26291   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPPPPPPQLAMEKRRKRGEEGEDEGGLNYESGEDMKLEENGVDANNNDNDNDDDDDDGDGDNGNGNGGGGGGDQKGKKKKRKKMPAKNLMAERRRRKKLNDKLYMLRSVVPNISKMDRASILGDAIDYLRELQVRITDLNHELESGPPGSSLPPAASFHPVTPTLPTLPCRVKEEICPISLPSPKNQSAKVEVTVREGGAVNIHMFCAHRPGLLLSTMRAMDSLGLDVQQAVISCFNGFSLDVFRAEQCREGQDVLPEQIKEVLLDTAGFHGMM*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain