SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g25860): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g25860): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma16g25860

Feature Type:gene_model
Chromosome:Gm16
Start:30011909
stop:30014543
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma16g25860
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G50820AT Annotation by Michelle Graham. TAIR10: photosystem II subunit O-2 | chr3:18891008-18892311 REVERSE LENGTH=331 SoyBaseE_val: 0ISS
GO:0000165GO-bp Annotation by Michelle Graham. GO Biological Process: MAPK cascade SoyBaseN/AISS
GO:0006098GO-bp Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0009617GO-bp Annotation by Michelle Graham. GO Biological Process: response to bacterium SoyBaseN/AISS
GO:0009657GO-bp Annotation by Michelle Graham. GO Biological Process: plastid organization SoyBaseN/AISS
GO:0009773GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem I SoyBaseN/AISS
GO:0009862GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0009867GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway SoyBaseN/AISS
GO:0009902GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast relocation SoyBaseN/AISS
GO:0009965GO-bp Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0010205GO-bp Annotation by Michelle Graham. GO Biological Process: photoinhibition SoyBaseN/AISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0010310GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0019761GO-bp Annotation by Michelle Graham. GO Biological Process: glucosinolate biosynthetic process SoyBaseN/AISS
GO:0030003GO-bp Annotation by Michelle Graham. GO Biological Process: cellular cation homeostasis SoyBaseN/AISS
GO:0030154GO-bp Annotation by Michelle Graham. GO Biological Process: cell differentiation SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0035304GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation SoyBaseN/AISS
GO:0042549GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II stabilization SoyBaseN/AISS
GO:0042742GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium SoyBaseN/AISS
GO:0042793GO-bp Annotation by Michelle Graham. GO Biological Process: transcription from plastid promoter SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0070838GO-bp Annotation by Michelle Graham. GO Biological Process: divalent metal ion transport SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009543GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid lumen SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0009654GO-cc Annotation by Michelle Graham. GO Cellular Compartment: oxygen evolving complex SoyBaseN/AISS
GO:0010287GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastoglobule SoyBaseN/AISS
GO:0030095GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast photosystem II SoyBaseN/AISS
GO:0031977GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid lumen SoyBaseN/AISS
GO:0005509GO-mf Annotation by Michelle Graham. GO Molecular Function: calcium ion binding SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0008266GO-mf Annotation by Michelle Graham. GO Molecular Function: poly(U) RNA binding SoyBaseN/AISS
GO:0010242GO-mf Annotation by Michelle Graham. GO Molecular Function: oxygen evolving activity SoyBaseN/AISS
PF01716PFAM Manganese-stabilising protein / photosystem II polypeptide JGI ISS
UniRef100_I1MNK0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1MNK0_SOYBN SoyBaseE_val: 0ISS
UniRef100_P14226UniRef Annotation by Michelle Graham. Most informative UniRef hit: Oxygen-evolving enhancer protein 1, chloroplastic n=1 Tax=Pisum sativum RepID=PSBO_PEA SoyBaseE_val: 0ISS

Expression Patterns of Glyma16g25860
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g25860 not represented in the dataset
Glyma16g25860 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma16g25860
ParalogEvidenceComments
Glyma02g06830 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma16g25860 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.16g143600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma16g25860
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma16g25860
>Glyma16g25860.1   sequence type=CDS   gene model=Glyma16g25860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGCGTCACTACAAGCAGCAGCTACTTTCATGCAACCCACCAAGTTGAGCAGGAGCAACACTTTGCAGCAAAAGTCTACTCAGTCCATTTCCAAGGCTTTTGGTTTGGAACCTGTTGGAGCTAAAAAGGTCACATGCTCCCTTCAGGCTGATCTTAAGGACTTGGCTCACAAGTGTGTTGATGCTACCAAAATTGCAGGATTCGCCCTTGCCACCTCTGCCCTCGTTGTCTCTGGGGCAAGTGCTGAAGGTGTTCCAAAGAGGCTAACCTTCGACGAAATCCAGAGCAAGACCTACTTGGAAGTGAAGGGGACAGGAACAGCAAACCAGTGCCCAACAATTGATGGTGGATTGGACTCATTTGCCTTCAAGCCGGGGAAATACAATGCCAAGAAGTTGTGCCTTGAGCCAACTTCATTCACAGTGAAGGCCGAGGGTGTGGCCAAGAATGCTCCCCTTGAGTTCCAAAACACAAAGCTCATGACACGTTTGACCTACACTCTGGATGAGATTGAGGGACCCTTTGAGGTGTCTTCTGATGGCACTGTCAAGTTTGAGGAGAAGGATGGCATTGACTACGCCGCCGTGACAGTTCAGCTACCGGGAGGCGAACGTGTGCCCTTTCTCTTCACCATCAAGCAGTTGGTGGCATCAGGGAAGCCAGATAGCTTTAGTGGGGAGTTTCTAGTCCCATCCTACCGTGGAAGCTCTTTCTTGGACCCCAAGGGAAGAGGTGCTTCCACAGGTTATGACAATGCAGTTGCTTTGCCTGCTGGTGGAAGAGGAGATGAGGAAGAACTTGCCAAGGAAAACAATAAAAGTGCCTCATCATCCAAGGGCAAAATCACCTTGAGTGTCACCAAGACCAAGCCTGAGACGGGTGAGGTTATCGGTGTGTTCGAGAGTGTTCAACCATCTGACACTGATTTGGGAGCAAAGGCTCCAAAGGATGTCAAGATCCAGGGCATCTGGTATGCTCAGCTTGAGTCATAG
Predicted protein sequences of Glyma16g25860
>Glyma16g25860.1   sequence type=predicted peptide   gene model=Glyma16g25860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAASLQAAATFMQPTKLSRSNTLQQKSTQSISKAFGLEPVGAKKVTCSLQADLKDLAHKCVDATKIAGFALATSALVVSGASAEGVPKRLTFDEIQSKTYLEVKGTGTANQCPTIDGGLDSFAFKPGKYNAKKLCLEPTSFTVKAEGVAKNAPLEFQNTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPDSFSGEFLVPSYRGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELAKENNKSASSSKGKITLSVTKTKPETGEVIGVFESVQPSDTDLGAKAPKDVKIQGIWYAQLES*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo