Glyma16g25530 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma16g25530

Feature Type:	gene_model
Chromosome:	Gm16
Start:	29525191
stop:	29525768
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g25530

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G17130	AT	Annotation by Michelle Graham. TAIR10: Plant invertase/pectin methylesterase inhibitor superfamily protein \| chr3:5844495-5845046 REVERSE LENGTH=183	SoyBase	E_val: 2.00E-13	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0004857	GO-mf	Annotation by Michelle Graham. GO Molecular Function: enzyme inhibitor activity	SoyBase	N/A	ISS
GO:0030599	GO-mf	Annotation by Michelle Graham. GO Molecular Function: pectinesterase activity	SoyBase	N/A	ISS
GO:0046910	GO-mf	Annotation by Michelle Graham. GO Molecular Function: pectinesterase inhibitor activity	SoyBase	N/A	ISS
PF04043	PFAM	Plant invertase/pectin methylesterase inhibitor	JGI		ISS
UniRef100_G7JP01	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Pectinesterase inhibitor n=1 Tax=Medicago truncatula RepID=G7JP01_MEDTR	SoyBase	E_val: 6.00E-33	ISS
UniRef100_I1MNH2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1MNH2_SOYBN	SoyBase	E_val: 2.00E-61	ISS

Expression Patterns of Glyma16g25530

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma16g25530 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.16g140900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma16g25530

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g25530

Limit To All Plant Sequences

>Glyma16g25530.2   sequence type=CDS   gene model=Glyma16g25530   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGGAGGAGCTCATTCTTAGTGTCCTATTTTCTACTCCATATTCTTCTTCTATCTTCCCCCAAAAGTGATACAAAAGGTTTGGCCCTCATAATGGTCAATGCCATTCTAGCAAATGCTACTGACACATTGAATTACATTAAAAAGCATATCAAGATAACTCCAGACTTAGAATTGGAGCATAAATTGGCTTTATGTGCTGACTCTTACTCCCCAGTTGTGATGTACATTCTCCCACAAGCAGCTGATGCCATAAGCCAAGGACAATTTGGAGATGACATTTTGCAGAAGCTATCGGATGTGGCTGCAGCCATACTGAAACTATTATTAAATAACTTATTTGAATATGATAAGATTTACATTTACGTATAA

Predicted protein sequences of Glyma16g25530

Limit To All Plant Sequences

>Glyma16g25530.2   sequence type=predicted peptide   gene model=Glyma16g25530   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRRSSFLVSYFLLHILLLSSPKSDTKGLALIMVNAILANATDTLNYIKKHIKITPDLELEHKLALCADSYSPVVMYILPQAADAISQGQFGDDILQKLSDVAAAILKLLLNNLFEYDKIYIYV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain