SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma16g25476

Feature Type:gene_model
Chromosome:Gm16
Start:29468507
stop:29469903
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G66780AT Annotation by Michelle Graham. TAIR10: unknown protein; Has 1807 Blast hits to 1807 proteins in 277 species: Archae - 0; Bacteria - 0; Metazoa - 736; Fungi - 347; Plants - 385; Viruses - 0; Other Eukaryotes - 339 (source: NCBI BLink). | chr5:26663627-26664196 FORWARD LENGTH=121 SoyBaseE_val: 1.00E-17ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_G7KDJ4UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Medicago truncatula RepID=G7KDJ4_MEDTR SoyBaseE_val: 3.00E-28ISS
UniRef100_Q9FL02UniRef Annotation by Michelle Graham. Most informative UniRef hit: AT5g66780/MUD21_2 n=1 Tax=Arabidopsis thaliana RepID=Q9FL02_ARATH SoyBaseE_val: 7.00E-15ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g25476 not represented in the dataset

Glyma16g25476 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.16g140500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma16g25476.1   sequence type=CDS   gene model=Glyma16g25476   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGCTTCACACAATGAAGAAGTTTCTAACCTATCCATTTACTCCGTTTCCAATATCTCTCTCTTCCAATCTTGGCAGGGGATCAACTTCGGTTCTAACATTCAGCACCCACCCTGATAGTGTTCTGGATAAGACTCAACACCCGACTGAGAAAGCTACAGAGAATGTGATGTCTAATTCGTTTGTGGAAGGGTATGCTTCAAGGTCGGATGAAAAAGGATTTGAAGGGGCTAGTGAAGGAAAACAATCCACATCAAAAGTTGAGATGGATAAGTTCATCCATGAAAATCACCCAGCTTATGACAAGGCACAGAGAAATGAGGTTAAGGAAAAAAACAAAACAAGGCACTAA

>Glyma16g25476.1   sequence type=predicted peptide   gene model=Glyma16g25476   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMLHTMKKFLTYPFTPFPISLSSNLGRGSTSVLTFSTHPDSVLDKTQHPTEKATENVMSNSFVEGYASRSDEKGFEGASEGKQSTSKVEMDKFIHENHPAYDKAQRNEVKEKNKTRH*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo