Glyma16g25426 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g25426): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g25426): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma16g25426

Feature Type:	gene_model
Chromosome:	Gm16
Start:	29387288
stop:	29387923
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g25426

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G38490	AT	Annotation by Michelle Graham. TAIR10: CBL-interacting protein kinase 22 \| chr2:16113909-16115276 REVERSE LENGTH=455	SoyBase	E_val: 3.00E-70	ISS
GO:0006468	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein phosphorylation	SoyBase	N/A	ISS
GO:0007165	GO-bp	Annotation by Michelle Graham. GO Biological Process: signal transduction	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0004672	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein kinase activity	SoyBase	N/A	ISS
GO:0004674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity	SoyBase	N/A	ISS
GO:0004713	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein tyrosine kinase activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016301	GO-mf	Annotation by Michelle Graham. GO Molecular Function: kinase activity	SoyBase	N/A	ISS
GO:0016772	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups	SoyBase	N/A	ISS
KOG0580	KOG	Serine/threonine protein kinase	JGI		ISS
PTHR24343	Panther	SERINE/THREONINE KINASE	JGI		ISS
PTHR24343:SF45	Panther	SERINE/THREONINE-PROTEIN KINASE PTK1,2/STK1,2	JGI		ISS
PF00069	PFAM	Protein kinase domain	JGI		ISS
UniRef100_A5BHI9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: CBL-interacting protein kinase 08 n=1 Tax=Vitis vinifera RepID=A5BHI9_VITVI	SoyBase	E_val: 8.00E-79	ISS
UniRef100_I1MNG4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1MNG4_SOYBN	SoyBase	E_val: 4.00E-147	ISS

Expression Patterns of Glyma16g25426

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g25426 not represented in the dataset	Glyma16g25426 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma16g25426 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.16g140000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma16g25426

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g25426

Limit To All Plant Sequences

>Glyma16g25426.1   sequence type=CDS   gene model=Glyma16g25426   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGTTGAAGGCCGTCAGCAAGCCTACGCTAGAGAAAAACGGTTACGCGGTGCACGTGGAGTGCAAGGTCGCTATCATGCGCCAACTACGCCACCCGCACACAATAAGCCTCTACGAGGTCCTCGCCACGAGGACCAAAATCTACTTCGTGATGGAGTTCGCCGTGCGCGGCGAACTCTTTCACGTGGTTGCCGTGGAGGCCGTATACCATCATCAGAAGTACTTCTGGCAACTCCTCTCTTCCATGAGACACTGTCCCTCACACGGCGTATACCATCGCGATTTAAAGCTCGACAACATTCATTTCGACCAAGACATGAACCTCAATGTCTCCGACTTCGGATTGAGCGCGTTGAGGAGCCGGATCCAACACGACGGCATGTTACACAATTTGTGTGGGACCCCTGCATACGTGGCGCCCGAGATTCTCGCGAGGAAGGGGTACGACGGTGCCATCATGGACGTGTGGTCGTGCGACATCGTTTTGTTCGTGCTCAACGCTGGGTACTTACCCTTCAATGATTACAATGTTACGATTTTATATAGGAAGATCAAGAATCTAGTGACGAGGTTGTTAGACACGAATCCCGAGACAAGGATTGTTATGAACAAAAACTATTATATGTTATGCTAA

Predicted protein sequences of Glyma16g25426

Limit To All Plant Sequences

>Glyma16g25426.1   sequence type=predicted peptide   gene model=Glyma16g25426   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVLKAVSKPTLEKNGYAVHVECKVAIMRQLRHPHTISLYEVLATRTKIYFVMEFAVRGELFHVVAVEAVYHHQKYFWQLLSSMRHCPSHGVYHRDLKLDNIHFDQDMNLNVSDFGLSALRSRIQHDGMLHNLCGTPAYVAPEILARKGYDGAIMDVWSCDIVLFVLNAGYLPFNDYNVTILYRKIKNLVTRLLDTNPETRIVMNKNYYMLC*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain