Glyma16g24751 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma16g24751

Feature Type:	gene_model
Chromosome:	Gm16
Start:	28734982
stop:	28737344
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g24751

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G66430	AT	Annotation by Michelle Graham. TAIR10: S-adenosyl-L-methionine-dependent methyltransferases superfamily protein \| chr5:26525410-26526799 REVERSE LENGTH=354	SoyBase	E_val: 4.00E-24	ISS
GO:0016114	GO-bp	Annotation by Michelle Graham. GO Biological Process: terpenoid biosynthetic process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0008168	GO-mf	Annotation by Michelle Graham. GO Molecular Function: methyltransferase activity	SoyBase	N/A	ISS
PF03492	PFAM	SAM dependent carboxyl methyltransferase	JGI		ISS
UniRef100_B5A7G5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Salicylic acid methyl transferase-like protein n=1 Tax=Glycine max RepID=B5A7G5_SOYBN	SoyBase	E_val: 8.00E-57	ISS
UniRef100_UPI000233F1CB	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233F1CB related cluster n=1 Tax=unknown RepID=UPI000233F1CB	SoyBase	E_val: 3.00E-86	ISS

Expression Patterns of Glyma16g24751

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g24751 not represented in the dataset	Glyma16g24751 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma16g24751

Paralog	Evidence	Comments
Glyma02g06050	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma16g24751 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.16g134100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma16g24751

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g24751

Limit To All Plant Sequences

>Glyma16g24751.1   sequence type=CDS   gene model=Glyma16g24751   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGTAGCACAGGCTGTGCACATGAAAGGGGGCCCTGGAGATGCAAGCTATGGAAATCAAGATTCAATGTGGGATTTGGATTTTTTTTCTAATTCACCCCCTCACACCCAGCACTCTTTGGGCTTTGATACTAAGAAGAAATCTGGGTCTAACTCAACCCTAAAAACTAGCTCAAGGGGCCTAATTGTAACAAGCCTCTGTAGCACACTCCCCAGAAGCTTGACAATTGCAGATTTGGGTTGCTCTTTTGGACCAAACACTTTGTTAGTGGTGTCAGAATTAATCAAGACTGTGGAGAAGCTTTGCCGAGAACTGAACCATAAATCTCTTGAATACAAGGCATTTTTTAATGATCTCCCTGGGAACGACTTCAACAACCTCTTTATGTCCCTTAACATCTTCAAAGAGAATTTGTGTGATAAAATGAAAACTAGGATTGGTCCATGCTACTTCTTTGGGGCTCCCGATTCTTTCTATGACATGCTTTTCCCAAATCGAAGCCTGCATTTTGTCCATTCCTCTTACACAACCTTCAATGGCTATCTAAGGTAA

Predicted protein sequences of Glyma16g24751

Limit To All Plant Sequences

>Glyma16g24751.1   sequence type=predicted peptide   gene model=Glyma16g24751   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEVAQAVHMKGGPGDASYGNQDSMWDLDFFSNSPPHTQHSLGFDTKKKSGSNSTLKTSSRGLIVTSLCSTLPRSLTIADLGCSFGPNTLLVVSELIKTVEKLCRELNHKSLEYKAFFNDLPGNDFNNLFMSLNIFKENLCDKMKTRIGPCYFFGAPDSFYDMLFPNRSLHFVHSSYTTFNGYLR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain