Report for Sequence Feature Glyma16g23340
Feature Type: gene_model
Chromosome: Gm16
Start: 27048546
stop: 27052333
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma16g23340
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G35950 AT
Annotation by Michelle Graham. TAIR10: RAC-like 6 | chr4:17024051-17025514 REVERSE LENGTH=197
SoyBase E_val: 2.00E-127 ISS
GO:0007015 GO-bp
Annotation by Michelle Graham. GO Biological Process: actin filament organization
SoyBase N/A ISS
GO:0007264 GO-bp
Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction
SoyBase N/A ISS
GO:0005622 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: intracellular
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0005737 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm
SoyBase N/A ISS
GO:0005525 GO-mf
Annotation by Michelle Graham. GO Molecular Function: GTP binding
SoyBase N/A ISS
KOG0393
KOG
Ras-related small GTPase, Rho type
JGI ISS
PTHR24072 Panther
FAMILY NOT NAMED
JGI ISS
PTHR24072:SF353 Panther
JGI ISS
PF00071 PFAM
Ras family
JGI ISS
UniRef100_Q9SXT7 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Rac-type small GTP-binding protein n=1 Tax=Cicer arietinum RepID=Q9SXT7_CICAR
SoyBase E_val: 1.00E-129 ISS
UniRef100_UPI00019A9EAC UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI00019A9EAC related cluster n=1 Tax=unknown RepID=UPI00019A9EAC
SoyBase E_val: 8.00E-143 ISS
Expression Patterns of Glyma16g23340
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma16g23340
Paralog Evidence Comments
Glyma02g05160 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma16g23340 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.16g124400 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma16g23340
Coding sequences of Glyma16g23340
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma16g23340.1 sequence type=CDS gene model=Glyma16g23340 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAGCGCTTCTAGGTTCATCAAGTGTGTCACTGTCGGGGATGGAGCCGTGGGCAAAACTTGTTTGCTAATCTCCTACACCAGCAACACCTTCCCCACTGATTATGTGCCAACTGTTTTCGACAATTTCAGCGCAAATGTGGTTGTGAATGGAGCCACTGTTAATCTAGGATTATGGGACACTGCCGGTCAAGAGGATTATAATAGATTACGACCTTTGAGTTATCGTGGTGCCGATGTTTTCATATTAGCTTTCTCTCTGATTAGCAAGGCCAGTTATGAAAATGTTTCCAAGAAGTGGATTCCAGAGTTGAAACATTATGCACCTGATGTTCCCATTATTTTGGTTGGCACAAAGCTTGACCTTCGAGATGATAAGCAGTTCTTCATAGACCATCCTGGTGCTGTACCCATTACCACCGTTCAGGGAGAAGAACTTATGAAGCTGATTAATGCACCTGCTTACATTGAATGCAGTTCGAAATCACAACAGAACGTGAAGGCAGTATTTGATGCAGCCATAAGAGTTGTCCTTCAACCACCAAAGCAAAAGAAAAAGAAGAGTAAAGCACAAAAGGCATGTTCAATATTGTGA
Predicted protein sequences of Glyma16g23340
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma16g23340.1 sequence type=predicted peptide gene model=Glyma16g23340 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGATVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPDVPIILVGTKLDLRDDKQFFIDHPGAVPITTVQGEELMKLINAPAYIECSSKSQQNVKAVFDAAIRVVLQPPKQKKKKSKAQKACSIL*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
