Glyma16g22935 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g22935): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g22935): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma16g22935

Feature Type:	gene_model
Chromosome:	Gm16
Start:	26564269
stop:	26565120
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g22935

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G51380	AT	Annotation by Michelle Graham. TAIR10: IQ-domain 20 \| chr3:19074036-19074426 REVERSE LENGTH=103	SoyBase	E_val: 1.00E-31	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005516	GO-mf	Annotation by Michelle Graham. GO Molecular Function: calmodulin binding	SoyBase	N/A	ISS
PTHR10699	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR10699:SF9	Panther	CALMODULIN BINDING	JGI		ISS
PF00612	PFAM	IQ calmodulin-binding motif	JGI		ISS
UniRef100_G7LAA6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: IQ domain-containing protein n=1 Tax=Medicago truncatula RepID=G7LAA6_MEDTR	SoyBase	E_val: 4.00E-53	ISS
UniRef100_UPI000233EEF2	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233EEF2 related cluster n=1 Tax=unknown RepID=UPI000233EEF2	SoyBase	E_val: 7.00E-99	ISS

Expression Patterns of Glyma16g22935

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g22935 not represented in the dataset	Glyma16g22935 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma16g22935 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.16g121000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma16g22935

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g22935

Limit To All Plant Sequences

>Glyma16g22935.1   sequence type=CDS   gene model=Glyma16g22935   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTGTACCCCAAAAATGGTTCAGAAATATAGTTCGGGGCAGATTCCTCAGATCATCCAACAAAGACATCGTTCTCGTTCTCCCTCGCACAAGTATTTGCACCAATGAATGCGAAGAAGCCATGCTTAGGAATGAAGAGTTCAGTTTCCCAACACCAATTTCTTCAATCACCAAGGAAGATGCTTCGGCCATTAAGATCCAAGCTTACTTCAGGGGACATCTTGCCAGACGAGCATATAAGGCTTTGAAGAGCCTAGTGAAGCTGCAAGCATTAGTTCGTGGGGTGTGGGTGAGGAAACAATCACGTATAGCAATGCAGTGTATGCACGCACTTGTACGATTACAAGTCAGGGTTCGTGCGAGGCAGCTCCTAGGTAGCTTTGATAAGGAACGACCTACTAATTTACAAAGTCAAAATGTATAG

Predicted protein sequences of Glyma16g22935

Limit To All Plant Sequences

>Glyma16g22935.1   sequence type=predicted peptide   gene model=Glyma16g22935   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGVPQKWFRNIVRGRFLRSSNKDIVLVLPRTSICTNECEEAMLRNEEFSFPTPISSITKEDASAIKIQAYFRGHLARRAYKALKSLVKLQALVRGVWVRKQSRIAMQCMHALVRLQVRVRARQLLGSFDKERPTNLQSQNV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain