SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g22680): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g22680): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma16g22680

Feature Type:gene_model
Chromosome:Gm16
Start:26279703
stop:26281396
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G12500AT Annotation by Michelle Graham. TAIR10: basic chitinase | chr3:3962501-3963984 REVERSE LENGTH=335 SoyBaseE_val: 4.00E-146ISS
GO:0005975GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process SoyBaseN/AISS
GO:0009871GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid and ethylene-dependent systemic resistance, ethylene mediated signaling pathway SoyBaseN/AISS
GO:0010167GO-bp Annotation by Michelle Graham. GO Biological Process: response to nitrate SoyBaseN/AISS
GO:0015706GO-bp Annotation by Michelle Graham. GO Biological Process: nitrate transport SoyBaseN/AISS
GO:0016998GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall macromolecule catabolic process SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0004568GO-mf Annotation by Michelle Graham. GO Molecular Function: chitinase activity SoyBaseN/AISS
GO:0008061GO-mf Annotation by Michelle Graham. GO Molecular Function: chitin binding SoyBaseN/AISS
KOG4742 KOG Predicted chitinase JGI ISS
PTHR22595Panther CHITINASE-RELATED JGI ISS
PTHR22595:SF11Panther CLASS I CHITINASE JGI ISS
PF00182PFAM Chitinase class I JGI ISS
PF00187PFAM Chitin recognition protein JGI ISS
UniRef100_I1MMY2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1MMY2_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q9SDY6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Chitinase class I n=2 Tax=Glycine max RepID=Q9SDY6_SOYBN SoyBaseE_val: 1.00E-168ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g22680 not represented in the dataset

Glyma16g22680 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma02g04820 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.16g119200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma16g22680.1   sequence type=CDS   gene model=Glyma16g22680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTAACATGAAATTGTGTCCTTTGATGCTATGCTTGTTATTAGCATTCTTGCTTGGGGCCGCAGCACAAAATTGTGGTACCCAAGTTGGTGGCGTGATATGCCCAAATGGTTTATGTTGCAGTCAATATGGGTGGTGTGGTAACACAGAAGCCCATTGTGGAAGAGGTTGCCAGAGCCAATGTACACCTGGCTCCACACCAACACCAACAACACCTAGTGGAGGAGATATAAGCAACACCATTAGCCGTTCTCAATTTGAAGAAATGCTTAAACACCGAAACGATGCAGCGTGTCCCGGGCGTAATTTCTACACCTATGATGCTTTCATTGCTGCTGCTCGCTCTTTCAATGGCTTTGGCACAACCGGTGATATAACCACTCGCAGGAGGGAGATTGCTGCTTTCTTCGGTCAAACTTCTCATGAAACCACAGGAGGGTGGGCAAGTGCACCAGATGGTCCATACGCGTGGGGATATTGTTTTATCAACGAACGCAACCAGGCAGATTATTGTACTAGCGGCACCCGATGGCCTTGTGCTCCTGGTAAAAAGTATTATGGCCGAGGACCAATCCAACTCACACACAACTACAATTACGGGCTAGCAGGAGAACAACTTAATCTAAATTTGCTAAACGACCCGGATCTAGTATCCAGAGACCCAATTGTGGCATTCAGAACAGCCATATGGTTTTGGATGACCGCACAGGGAAACAAGCCATCAAGCCATAGTGTGATTATTGGAACATGGAACCCATCTAGTGCTGACTGGCAAGCGGGTCGGGTCCCCGGATACGGTGTGATCACCAACATAATCAATGGCGGGCTCGAATGCGGACGGGGCCCGGATTCTCGGGTCCAAAGTCGGATCGGGTTCTACGAAAGGTACTGCCAAATCTTTGGAGTGAGCCCCGGGAACAACTTGGATTGCAACAATCAAAGGCCATTTTAA

>Glyma16g22680.1   sequence type=predicted peptide   gene model=Glyma16g22680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGNMKLCPLMLCLLLAFLLGAAAQNCGTQVGGVICPNGLCCSQYGWCGNTEAHCGRGCQSQCTPGSTPTPTTPSGGDISNTISRSQFEEMLKHRNDAACPGRNFYTYDAFIAAARSFNGFGTTGDITTRRREIAAFFGQTSHETTGGWASAPDGPYAWGYCFINERNQADYCTSGTRWPCAPGKKYYGRGPIQLTHNYNYGLAGEQLNLNLLNDPDLVSRDPIVAFRTAIWFWMTAQGNKPSSHSVIIGTWNPSSADWQAGRVPGYGVITNIINGGLECGRGPDSRVQSRIGFYERYCQIFGVSPGNNLDCNNQRPF*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo