SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g22370): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g22370): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma16g22370

Feature Type:gene_model
Chromosome:Gm16
Start:25794233
stop:25799361
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G17220AT Annotation by Michelle Graham. TAIR10: Protein kinase superfamily protein | chr2:7487866-7489768 REVERSE LENGTH=413 SoyBaseE_val: 5.00E-170ISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0006995GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to nitrogen starvation SoyBaseN/AISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0009863GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0010200GO-bp Annotation by Michelle Graham. GO Biological Process: response to chitin SoyBaseN/AISS
GO:0031347GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of defense response SoyBaseN/AISS
GO:0031348GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response SoyBaseN/AISS
GO:0045087GO-bp Annotation by Michelle Graham. GO Biological Process: innate immune response SoyBaseN/AISS
GO:0050832GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to fungus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0004713GO-mf Annotation by Michelle Graham. GO Molecular Function: protein tyrosine kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
KOG1187 KOG Serine/threonine protein kinase JGI ISS
PTHR24420Panther FAMILY NOT NAMED JGI ISS
PTHR24420:SF531Panther JGI ISS
PF07714PFAM Protein tyrosine kinase JGI ISS
UniRef100_G7L9D6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Serine/threonine protein kinase BIK1 n=1 Tax=Medicago truncatula RepID=G7L9D6_MEDTR SoyBaseE_val: 0ISS
UniRef100_I1L4R2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L4R2_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g22370 not represented in the dataset

Glyma16g22370 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma09g33120 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma16g22370.1   sequence type=CDS   gene model=Glyma16g22370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTCTCTGCTTCTCCTCCTCTTCATCCACACCTCACTCCTCTTCCCTCAACCGCCCTCAGCAGTACTCAGGCTCAGCGAGCACTGACACCAAGAACGTGGGATTCTCCGCGACCACGAGCAGCGCCGGGAAGAGCCAATTCTCGGAGATCGCGAGTGGGAGCATCAACAGCAGCCAAGGCTCTCTTCCTCTTCCTCTTCCTTCTCCCGATGGCCAGATTCTAGAAAGGCCGAACCTGAAGGTGTTCAGCTTCGGAGACCTGAAATCTGCCACCAAGAGTTTCAAGTCCGATACATTGCTCGGTGAAGGCGGGTTCGGAAGAGTTTACAAGGGATGGTTGGATGAGAAGACCCTCTCCCCGGCCAAAGCAGGCTCCGGAATGGTCGTTGCCATCAAAAAGTTGAACCCCGAAAGCACGCAAGGCTTCCAAGAGTGGCAGTCAGAAGTGAACTTTTTAGGAAGGCTTTCTCACCCCAACCTGGTCAAGTTGTTGGGTTATTGTTGGGACGATGATGAGCTTCTTCTTGTTTATGAATTCTTGCCAAAGGGAAGCTTGGAGAATCATCTTTTCAGAAGAAATCCTAACATAGAACCACTTTCTTGGAACACCCGGCTTAAAATAGCTATTGGTGCAGCTCGGGGATTAGCTTTCTTGCACGCCTCCGAAAAGCAAGTCATATACCGAGACTTCAAGGCCTCAAATATACTTCTCGATTTGAATTTCAATGCAAAAATCTCAGATTTTGGCTTGGCGAAATTGGGGCCTTCTGGGGGACAATCACATGTAACTACCAGGGTCATGGGTACGTATGGTTATGCTGCTCCAGAATACATAGCAACAGGCCACTTGTATGTGAAGAGTGATGTCTACGGATTTGGCGTAGTGCTACTTGAAATACTGACAGGCATGCGGGCACTTGACACAAAACGGCCAACAGGGCAGCAGAACCTAGTTGAATGGACCAAGCCTCTTCTCTCTTCCAAGAAAAAGTTGAAAACAATAATGGATGCTAAGATAGTGGGTCAATATTCACCAAAGGCAGCGTTTCAAGCAGCACAACTTACTGTAAAATGTCTAGAACATGACCCCAAACAACGTCCTTCCATGAAAGAAGTGCTTGAGGGATTGGAAGCCATTGAAGCTATCCATGAAAAATCCAAGGAATCCAAAACCCGCAATTCTTATCAATCTCCTCGGCAGAGAGTTGTGAGAGTATAA

>Glyma16g22370.1   sequence type=predicted peptide   gene model=Glyma16g22370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGLCFSSSSSTPHSSSLNRPQQYSGSASTDTKNVGFSATTSSAGKSQFSEIASGSINSSQGSLPLPLPSPDGQILERPNLKVFSFGDLKSATKSFKSDTLLGEGGFGRVYKGWLDEKTLSPAKAGSGMVVAIKKLNPESTQGFQEWQSEVNFLGRLSHPNLVKLLGYCWDDDELLLVYEFLPKGSLENHLFRRNPNIEPLSWNTRLKIAIGAARGLAFLHASEKQVIYRDFKASNILLDLNFNAKISDFGLAKLGPSGGQSHVTTRVMGTYGYAAPEYIATGHLYVKSDVYGFGVVLLEILTGMRALDTKRPTGQQNLVEWTKPLLSSKKKLKTIMDAKIVGQYSPKAAFQAAQLTVKCLEHDPKQRPSMKEVLEGLEAIEAIHEKSKESKTRNSYQSPRQRVVRV*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo