|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G75750 | AT | Annotation by Michelle Graham. TAIR10: GAST1 protein homolog 1 | chr1:28441813-28442284 REVERSE LENGTH=98 | SoyBase | E_val: 3.00E-25 | ISS |
| GO:0000271 | GO-bp | Annotation by Michelle Graham. GO Biological Process: polysaccharide biosynthetic process | SoyBase | N/A | ISS |
| GO:0006569 | GO-bp | Annotation by Michelle Graham. GO Biological Process: tryptophan catabolic process | SoyBase | N/A | ISS |
| GO:0009684 | GO-bp | Annotation by Michelle Graham. GO Biological Process: indoleacetic acid biosynthetic process | SoyBase | N/A | ISS |
| GO:0009737 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus | SoyBase | N/A | ISS |
| GO:0009739 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus | SoyBase | N/A | ISS |
| GO:0009741 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to brassinosteroid stimulus | SoyBase | N/A | ISS |
| GO:0009825 | GO-bp | Annotation by Michelle Graham. GO Biological Process: multidimensional cell growth | SoyBase | N/A | ISS |
| GO:0009826 | GO-bp | Annotation by Michelle Graham. GO Biological Process: unidimensional cell growth | SoyBase | N/A | ISS |
| GO:0009932 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell tip growth | SoyBase | N/A | ISS |
| GO:0010817 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of hormone levels | SoyBase | N/A | ISS |
| GO:0043481 | GO-bp | Annotation by Michelle Graham. GO Biological Process: anthocyanin accumulation in tissues in response to UV light | SoyBase | N/A | ISS |
| GO:0048767 | GO-bp | Annotation by Michelle Graham. GO Biological Process: root hair elongation | SoyBase | N/A | ISS |
| GO:0071555 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell wall organization | SoyBase | N/A | ISS |
| GO:0005576 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular region | SoyBase | N/A | ISS |
| GO:0005618 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cell wall | SoyBase | N/A | ISS |
| GO:0009505 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plant-type cell wall | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| PF02704 | PFAM | Gibberellin regulated protein | JGI | ISS | |
| UniRef100_C9E1T3 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Gast1-like protein n=1 Tax=Jatropha curcas RepID=C9E1T3_9ROSI | SoyBase | E_val: 4.00E-29 | ISS |
| UniRef100_I1MMS4 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MMS4_SOYBN | SoyBase | E_val: 1.00E-53 | ISS |
|
Glyma16g21230 not represented in the dataset |
Glyma16g21230 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.16g110600 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma16g21230.2 sequence type=CDS gene model=Glyma16g21230 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCCATCTCCAAAGCTTTGCTAGTTTCCGTCCTCATTTTTTCAATCATCCTAAATCACGTGGAATCAGATACAATGGCAACTACGACCTTGGGGAATGAACCAAGTTTTAATTTTTCCTCGTCAAATATTGATTGTTGTGTTGAATGCAATCGAAGATGTCAGTTATCATCAAGGCCAAATTTATGTAAGAGGGCATGTGGAACGTGTTGTCAAAGGTGCAATTGTGTGCCTACAGGTACCTATGGTCACTATGAAGAGTGTCCATGCTATGCGAATATGACCACCCACAAGGGAAAACACAAATGCCCTTAA
>Glyma16g21230.2 sequence type=predicted peptide gene model=Glyma16g21230 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MAISKALLVSVLIFSIILNHVESDTMATTTLGNEPSFNFSSSNIDCCVECNRRCQLSSRPNLCKRACGTCCQRCNCVPTGTYGHYEECPCYANMTTHKGKHKCP*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||