|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G27210 | AT | Annotation by Michelle Graham. TAIR10: BRI1 suppressor 1 (BSU1)-like 3 | chr2:11630188-11636182 FORWARD LENGTH=1006 | SoyBase | E_val: 1.00E-36 | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0004721 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: phosphoprotein phosphatase activity | SoyBase | N/A | ISS |
| GO:0004722 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine phosphatase activity | SoyBase | N/A | ISS |
| GO:0005506 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: iron ion binding | SoyBase | N/A | ISS |
| GO:0016787 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: hydrolase activity | SoyBase | N/A | ISS |
| GO:0030145 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: manganese ion binding | SoyBase | N/A | ISS |
| UniRef100_I1LU05 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Serine/threonine-protein phosphatase n=1 Tax=Glycine max RepID=I1LU05_SOYBN | SoyBase | E_val: 6.00E-37 | ISS |
| UniRef100_UPI0001B09212 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI0001B09212 related cluster n=1 Tax=unknown RepID=UPI0001B09212 | SoyBase | E_val: 5.00E-37 | ISS |
|
Glyma16g21175 not represented in the dataset |
Glyma16g21175 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma16g21175.1 sequence type=CDS gene model=Glyma16g21175 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGAGTTTGGAGTGGTGAATGCAATTTTGGAGAAGAAGGAGGATGAATTGGGGTCGAGGTGTGGCCACTTGTTGACAGCGGTGGAGGCAATCGGAGAGGAAGGGACACCGAGGCAATTCTACGTGTTAGGAACTCCTTCATTTGCTGGAAATGTTGGCATATGTTTAGCTGGTGCCACAGCTGATGTCCACTATTATGATGTCTTGACTAATAAATGGTCTAGGATAACTCCCTTTGGAGAACCTCTAACTTCAAGGGTTGTACATGTGGCGACTGCTGTAGGAACTATGGTGGTTATTCAGGAAGCATGGAAAGAATATCTTAATGTTTCTGAGCTTATTTCCTTTATTTAA
>Glyma16g21175.1 sequence type=predicted peptide gene model=Glyma16g21175 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MEFGVVNAILEKKEDELGSRCGHLLTAVEAIGEEGTPRQFYVLGTPSFAGNVGICLAGATADVHYYDVLTNKWSRITPFGEPLTSRVVHVATAVGTMVVIQEAWKEYLNVSELISFI*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||