SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g21150): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g21150): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma16g21150

Feature Type:gene_model
Chromosome:Gm16
Start:23894209
stop:23897294
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G09870AT Annotation by Michelle Graham. TAIR10: cellulose synthase 5 | chr5:3073356-3077974 FORWARD LENGTH=1069 SoyBaseE_val: 2.00E-49ISS
GO:0009832GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall biogenesis SoyBaseN/AISS
GO:0010192GO-bp Annotation by Michelle Graham. GO Biological Process: mucilage biosynthetic process SoyBaseN/AISS
GO:0010583GO-bp Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone SoyBaseN/AISS
GO:0016049GO-bp Annotation by Michelle Graham. GO Biological Process: cell growth SoyBaseN/AISS
GO:0030243GO-bp Annotation by Michelle Graham. GO Biological Process: cellulose metabolic process SoyBaseN/AISS
GO:0030244GO-bp Annotation by Michelle Graham. GO Biological Process: cellulose biosynthetic process SoyBaseN/AISS
GO:0042546GO-bp Annotation by Michelle Graham. GO Biological Process: cell wall biogenesis SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0016757GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups SoyBaseN/AISS
GO:0016759GO-mf Annotation by Michelle Graham. GO Molecular Function: cellulose synthase activity SoyBaseN/AISS
GO:0016760GO-mf Annotation by Michelle Graham. GO Molecular Function: cellulose synthase (UDP-forming) activity SoyBaseN/AISS
PTHR13301Panther X-BOX TRANSCRIPTION FACTOR-RELATED JGI ISS
PTHR13301:SF1Panther TGACG-MOTIF-BINDING FACTOR JGI ISS
PF03552PFAM Cellulose synthase JGI ISS
UniRef100_I1JDD7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JDD7_SOYBN SoyBaseE_val: 2.00E-62ISS
UniRef100_Q8L778UniRef Annotation by Michelle Graham. Most informative UniRef hit: Cellulose synthase A catalytic subunit 5 [UDP-forming] n=2 Tax=Arabidopsis thaliana RepID=CESA5_ARATH SoyBaseE_val: 1.00E-46ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g21150 not represented in the dataset

Glyma16g21150 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma16g21150.1   sequence type=CDS   gene model=Glyma16g21150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTCACAGAATTAAGTGGTCAAATTTGTCAGATCTATGGGGATGAGCTGGAAGTTACTGTGAATGGGGAGCCATTTGTTGATTGCAATGAATGTGCATTCCCTGTGTGCAGACCTTGTTATGAGTATGAAAGAAGAGAGGGCAACCGAGTTTTTCCTCAGTGTAAAACCAAATATAAGCGCATCAAAGGTAGTCCTAGAGTTGAGGGTGATGAAGAAGAGGATGATACTGATGATTTAGAAAGTGAATTTGATATTGGGAGTTTGACCCTGGTTTCAGTGTCCTTATTTAATGTGACAATTAATGATGGTGATGCAGTTCAACCAAGACCTATGGATCCTAAAAAAGATATTGTTGTTTATGTATATGGAAGTGTTGCATGGAAGGAACGGATGGAGGATTGGAAGAAAAAACAAAGTGAAAAACTTCTGGTTGTTAGACATGAAGGGGATAAAGATAGTGATGAGTTGGATGATCCGGACTTACCAAAAGCATGTCTAACTTACTTTGTTTCTTACAAACAACTAAATGTTAAACAGAAAACGATAGAGAGATTACTCATTAAAACTATATACAGTGGACCTTATGAAGGAACCTCCACTCATTACTGCAAACACAATTATAAATTGACTTCTCTGTTGTCCTTTTCTCAGCTATCCCGCACGGGGACAACTGGAAAAGGGGCAGCAGAGAAGCCAGGTCCTGCATGCTATGTCTCAAATGATGGTGCTGCCATGCTTACATTTGAAGCACTCTCCGGGACTTATGATTTTGCAAGGAAATGGGTTCCATTCTATAAGAAGTTCTGCATTAAACCACGGGCTCCTAAATGGTATTTTGCTCAAAAGGTTGACTACTTGAAGGATAGGGTGGATGCCGCATTTATAAGAGAA

>Glyma16g21150.1   sequence type=predicted peptide   gene model=Glyma16g21150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VTELSGQICQIYGDELEVTVNGEPFVDCNECAFPVCRPCYEYERREGNRVFPQCKTKYKRIKGSPRVEGDEEEDDTDDLESEFDIGSLTLVSVSLFNVTINDGDAVQPRPMDPKKDIVVYVYGSVAWKERMEDWKKKQSEKLLVVRHEGDKDSDELDDPDLPKACLTYFVSYKQLNVKQKTIERLLIKTIYSGPYEGTSTHYCKHNYKLTSLLSFSQLSRTGTTGKGAAEKPGPACYVSNDGAAMLTFEALSGTYDFARKWVPFYKKFCIKPRAPKWYFAQKVDYLKDRVDAAFIRE







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo