Glyma16g21150 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g21150): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g21150): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma16g21150

Feature Type:	gene_model
Chromosome:	Gm16
Start:	23894209
stop:	23897294
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma16g21150

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G09870	AT	Annotation by Michelle Graham. TAIR10: cellulose synthase 5 \| chr5:3073356-3077974 FORWARD LENGTH=1069	SoyBase	E_val: 2.00E-49	ISS
GO:0009832	GO-bp	Annotation by Michelle Graham. GO Biological Process: plant-type cell wall biogenesis	SoyBase	N/A	ISS
GO:0010192	GO-bp	Annotation by Michelle Graham. GO Biological Process: mucilage biosynthetic process	SoyBase	N/A	ISS
GO:0010583	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone	SoyBase	N/A	ISS
GO:0016049	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell growth	SoyBase	N/A	ISS
GO:0030243	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellulose metabolic process	SoyBase	N/A	ISS
GO:0030244	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellulose biosynthetic process	SoyBase	N/A	ISS
GO:0042546	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell wall biogenesis	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
GO:0016757	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring glycosyl groups	SoyBase	N/A	ISS
GO:0016759	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cellulose synthase activity	SoyBase	N/A	ISS
GO:0016760	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cellulose synthase (UDP-forming) activity	SoyBase	N/A	ISS
PTHR13301	Panther	X-BOX TRANSCRIPTION FACTOR-RELATED	JGI		ISS
PTHR13301:SF1	Panther	TGACG-MOTIF-BINDING FACTOR	JGI		ISS
PF03552	PFAM	Cellulose synthase	JGI		ISS
UniRef100_I1JDD7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JDD7_SOYBN	SoyBase	E_val: 2.00E-62	ISS
UniRef100_Q8L778	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cellulose synthase A catalytic subunit 5 [UDP-forming] n=2 Tax=Arabidopsis thaliana RepID=CESA5_ARATH	SoyBase	E_val: 1.00E-46	ISS

Expression Patterns of Glyma16g21150

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g21150 not represented in the dataset	Glyma16g21150 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma16g21150 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma16g21150

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma16g21150

Limit To All Plant Sequences

>Glyma16g21150.1   sequence type=CDS   gene model=Glyma16g21150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTCACAGAATTAAGTGGTCAAATTTGTCAGATCTATGGGGATGAGCTGGAAGTTACTGTGAATGGGGAGCCATTTGTTGATTGCAATGAATGTGCATTCCCTGTGTGCAGACCTTGTTATGAGTATGAAAGAAGAGAGGGCAACCGAGTTTTTCCTCAGTGTAAAACCAAATATAAGCGCATCAAAGGTAGTCCTAGAGTTGAGGGTGATGAAGAAGAGGATGATACTGATGATTTAGAAAGTGAATTTGATATTGGGAGTTTGACCCTGGTTTCAGTGTCCTTATTTAATGTGACAATTAATGATGGTGATGCAGTTCAACCAAGACCTATGGATCCTAAAAAAGATATTGTTGTTTATGTATATGGAAGTGTTGCATGGAAGGAACGGATGGAGGATTGGAAGAAAAAACAAAGTGAAAAACTTCTGGTTGTTAGACATGAAGGGGATAAAGATAGTGATGAGTTGGATGATCCGGACTTACCAAAAGCATGTCTAACTTACTTTGTTTCTTACAAACAACTAAATGTTAAACAGAAAACGATAGAGAGATTACTCATTAAAACTATATACAGTGGACCTTATGAAGGAACCTCCACTCATTACTGCAAACACAATTATAAATTGACTTCTCTGTTGTCCTTTTCTCAGCTATCCCGCACGGGGACAACTGGAAAAGGGGCAGCAGAGAAGCCAGGTCCTGCATGCTATGTCTCAAATGATGGTGCTGCCATGCTTACATTTGAAGCACTCTCCGGGACTTATGATTTTGCAAGGAAATGGGTTCCATTCTATAAGAAGTTCTGCATTAAACCACGGGCTCCTAAATGGTATTTTGCTCAAAAGGTTGACTACTTGAAGGATAGGGTGGATGCCGCATTTATAAGAGAA

Predicted protein sequences of Glyma16g21150

Limit To All Plant Sequences

>Glyma16g21150.1   sequence type=predicted peptide   gene model=Glyma16g21150   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VTELSGQICQIYGDELEVTVNGEPFVDCNECAFPVCRPCYEYERREGNRVFPQCKTKYKRIKGSPRVEGDEEEDDTDDLESEFDIGSLTLVSVSLFNVTINDGDAVQPRPMDPKKDIVVYVYGSVAWKERMEDWKKKQSEKLLVVRHEGDKDSDELDDPDLPKACLTYFVSYKQLNVKQKTIERLLIKTIYSGPYEGTSTHYCKHNYKLTSLLSFSQLSRTGTTGKGAAEKPGPACYVSNDGAAMLTFEALSGTYDFARKWVPFYKKFCIKPRAPKWYFAQKVDYLKDRVDAAFIRE

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain