|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G14300 | AT | Annotation by Michelle Graham. TAIR10: RNA-binding (RRM/RBD/RNP motifs) family protein | chr4:8231179-8232785 FORWARD LENGTH=411 | SoyBase | E_val: 1.00E-33 | ISS |
| GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
| GO:0000166 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleotide binding | SoyBase | N/A | ISS |
| GO:0003676 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding | SoyBase | N/A | ISS |
| GO:0003723 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: RNA binding | SoyBase | N/A | ISS |
| PTHR24012 | Panther | FAMILY NOT NAMED | JGI | ISS | |
| PTHR24012:SF14 | Panther | SUBFAMILY NOT NAMED | JGI | ISS | |
| PF00076 | PFAM | RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) | JGI | ISS | |
| UniRef100_B9SQV8 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Heterogeneous nuclear ribonucleoprotein 27C, putative n=1 Tax=Ricinus communis RepID=B9SQV8_RICCO | SoyBase | E_val: 4.00E-37 | ISS |
| UniRef100_UPI000233B4B6 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233B4B6 related cluster n=1 Tax=unknown RepID=UPI000233B4B6 | SoyBase | E_val: 1.00E-46 | ISS |
|
Glyma16g20672 not represented in the dataset |
Glyma16g20672 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.16g109600 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma16g20672.1 sequence type=CDS gene model=Glyma16g20672 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGATTCGGATCAAGGCAAGCTTTTCATCGGTGGGATTTCATGGGATACGACGGAGGACAAGCTCAAGGAGCATTTCGGTAACTACGGCGACGCTTTGAGCACTTCCATCATGCGGGAGAAGAACACTGGGAAGCCAAGGGGCTTCGGTTTCGTCGTTTTTGCAGATCCTAACATTCTAGATAGGGTTTTGGAAGACAAACATGTCATAGATGGCAGAACGGTAACGCTTCTATCATTTTTTTTGTCATTTCTTTACTTCATGTTCCGATTGAAAATATTGTATTGTACTTTTTAG
>Glyma16g20672.1 sequence type=predicted peptide gene model=Glyma16g20672 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MDSDQGKLFIGGISWDTTEDKLKEHFGNYGDALSTSIMREKNTGKPRGFGFVVFADPNILDRVLEDKHVIDGRTVTLLSFFLSFLYFMFRLKILYCTF*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||