SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g19531): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g19531): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma16g19531

Feature Type:gene_model
Chromosome:Gm16
Start:21561460
stop:21566101
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma16g19531
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G06350AT Annotation by Michelle Graham. TAIR10: ARM repeat superfamily protein | chr5:1938781-1944197 FORWARD LENGTH=877 SoyBaseE_val: 4.00E-83ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
PTHR16056Panther UNCHARACTERIZED JGI ISS
PTHR16056:SF2Panther TESTIS EXPRESSED GENE 10-RELATED JGI ISS
PF12333PFAM Rix1 complex component involved in 60S ribosome maturation JGI ISS
UniRef100_F4K3T5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Armadillo/beta-catenin-like repeat-containing protein n=1 Tax=Arabidopsis thaliana RepID=F4K3T5_ARATH SoyBaseE_val: 2.00E-80ISS
UniRef100_UPI0002338816UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002338816 related cluster n=1 Tax=unknown RepID=UPI0002338816 SoyBaseE_val: 3.00E-125ISS

Expression Patterns of Glyma16g19531
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g19531 not represented in the dataset
Glyma16g19531 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma16g19531 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.16g096800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma16g19531
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma16g19531
>Glyma16g19531.1   sequence type=CDS   gene model=Glyma16g19531   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AAAATAAGGCGAAAGGTTGGGAGGAAACTGCCACCACCAAAGAATACAACAGATACTGAAATTAAATCTAAAGCAATTGTTCTTCCGGAACAGAGTCTTGCGGCAGAGAAGGCAGGTTTGGCTGTAAACAAGAAAGGTTTGACTTTAAAAGAACTTCTCCAGCAAACATCTCATCACAATCCAAAAGTTCATAGAGATGCATTGATTGGTATTAAGGATTTATTCACCAGATATCCAGCTGAACAGAAGTTGCAAAAATATGCTGCTGTAGAAAAACTTCGTGAGCGCATTGGTGATGATGATAAAGTGGTTCGAAAATCATTATATGATCTTTTTAAAGTAGTGATTTTACCTTGCTGTAAAGAGGACAATCAAGAGCTGATCGTTTCTTTATTGATGCCTTACATTTTTAATGCAATGACTCATTTGGTGGTTGATGTTCGGATGATGGCATTTGATTTTTTAGACCTCATTCTTGAGTTTTATCCTCCTTCCTTTTCACCATCTTATGCAGAAAAGATTTTTCAGAATTATGAGGATATTCTAGTGAGGAACCAGTACTATTTATAG
Predicted protein sequences of Glyma16g19531
>Glyma16g19531.1   sequence type=predicted peptide   gene model=Glyma16g19531   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
KIRRKVGRKLPPPKNTTDTEIKSKAIVLPEQSLAAEKAGLAVNKKGLTLKELLQQTSHHNPKVHRDALIGIKDLFTRYPAEQKLQKYAAVEKLRERIGDDDKVVRKSLYDLFKVVILPCCKEDNQELIVSLLMPYIFNAMTHLVVDVRMMAFDFLDLILEFYPPSFSPSYAEKIFQNYEDILVRNQYYL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo