|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT3G08970 | AT | Annotation by Michelle Graham. TAIR10: DNAJ heat shock N-terminal domain-containing protein | chr3:2737589-2740265 FORWARD LENGTH=572 | SoyBase | E_val: 2.00E-16 | ISS |
GO:0006457 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein folding | SoyBase | N/A | ISS |
GO:0009408 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to heat | SoyBase | N/A | ISS |
GO:0009644 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to high light intensity | SoyBase | N/A | ISS |
GO:0009688 | GO-bp | Annotation by Michelle Graham. GO Biological Process: abscisic acid biosynthetic process | SoyBase | N/A | ISS |
GO:0009860 | GO-bp | Annotation by Michelle Graham. GO Biological Process: pollen tube growth | SoyBase | N/A | ISS |
GO:0010286 | GO-bp | Annotation by Michelle Graham. GO Biological Process: heat acclimation | SoyBase | N/A | ISS |
GO:0034605 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular response to heat | SoyBase | N/A | ISS |
GO:0042542 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide | SoyBase | N/A | ISS |
GO:0005788 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum lumen | SoyBase | N/A | ISS |
GO:0009506 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma | SoyBase | N/A | ISS |
GO:0016491 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity | SoyBase | N/A | ISS |
GO:0031072 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: heat shock protein binding | SoyBase | N/A | ISS |
GO:0051082 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: unfolded protein binding | SoyBase | N/A | ISS |
PTHR24077 | Panther | FAMILY NOT NAMED | JGI | ISS | |
PTHR24077:SF53 | Panther | JGI | ISS | ||
PF00226 | PFAM | DnaJ domain | JGI | ISS | |
UniRef100_G7KSB1 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Chaperone protein dnaJ n=1 Tax=Medicago truncatula RepID=G7KSB1_MEDTR | SoyBase | E_val: 1.00E-20 | ISS |
UniRef100_I1KKH4 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KKH4_SOYBN | SoyBase | E_val: 5.00E-38 | ISS |
Glyma16g19505 not represented in the dataset |
Glyma16g19505 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.16g097000 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma16g19505.1 sequence type=CDS gene model=Glyma16g19505 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAAGACCCGTTTTCCCTCCACACGGGTCATCTTCGTGGCCTCACTCTGTTTCCTTGCAAGCTTCGAATTATTGCAAGCCAAAACCATCGACCCCTACAAGGTTCTTGGGGTTGATAAAAATGCAAGTCAGCGGGAAATTCAGAAGGCTTTTAACAAGCTCTCTCTTCAGTATCACCCTGACAAGAACAAATCCAAGGGTGCATAA
>Glyma16g19505.1 sequence type=predicted peptide gene model=Glyma16g19505 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MKTRFPSTRVIFVASLCFLASFELLQAKTIDPYKVLGVDKNASQREIQKAFNKLSLQYHPDKNKSKGA*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||