SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g19464): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g19464): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma16g19464

Feature Type:gene_model
Chromosome:Gm16
Start:21378338
stop:21379022
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma16g19464
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G02065AT Annotation by Michelle Graham. TAIR10: squamosa promoter binding protein-like 8 | chr1:365625-366365 FORWARD LENGTH=246 SoyBaseE_val: 1.00E-46ISS
GO:0009554GO-bp Annotation by Michelle Graham. GO Biological Process: megasporogenesis SoyBaseN/AISS
GO:0009556GO-bp Annotation by Michelle Graham. GO Biological Process: microsporogenesis SoyBaseN/AISS
GO:0048653GO-bp Annotation by Michelle Graham. GO Biological Process: anther development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
PF03110PFAM SBP domain JGI ISS
UniRef100_G7LBJ7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Squamosa promoter binding protein n=1 Tax=Medicago truncatula RepID=G7LBJ7_MEDTR SoyBaseE_val: 1.00E-76ISS
UniRef100_I1MMQ4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1MMQ4_SOYBN SoyBaseE_val: 6.00E-111ISS

Expression Patterns of Glyma16g19464
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g19464 not represented in the dataset
Glyma16g19464 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma16g19464 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.16g097400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma16g19464
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma16g19464
>Glyma16g19464.1   sequence type=CDS   gene model=Glyma16g19464   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTCACCAGAAATGAAGACAGCTCTGCCACGGCCTCCGACCAAACCCACCGTCAAATTTTCGACCACTACGCGTCCAACACATTCATCCCCAACCACTTCCTACACGCGCCAATGCACTCCACCGCCACCACTGTCGCGACAACCACCGTAGATTTCACCCACAGCCACTTCAACCCGCAACCCCACCACCATAACCAGATGAACCACCACCAACATCACCACGCCTTCTTTGACCCACGCGCCTTCCATGACGCACTTCTCCTTGTCCCCAAGTCTGAAGAAGTCGGTTGGCCCATGGACTTTGTCGGCTCACGAATTGGACTCAATATGGGAGGACGAACTTACTTCTCGTCCTCTGAGGATGACTTCGTGAGCCGGCTCTACCGTCGGTCTAGGCCCGTCGAACCCGGTTCAACTATCTTGTCGAACTCGCCACGGTGTCAGGCCGAGGGATGCAATGCTGATCTGTCGCAAGCCAAGCACTATCACCACCGCCACAAGGTGTGCGAGTTTCACTCCAAAGCCGCCACTGTCATCGCCGCCGGCTTAACTCAACGATTATGCCAGTAA
Predicted protein sequences of Glyma16g19464
>Glyma16g19464.1   sequence type=predicted peptide   gene model=Glyma16g19464   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLTRNEDSSATASDQTHRQIFDHYASNTFIPNHFLHAPMHSTATTVATTTVDFTHSHFNPQPHHHNQMNHHQHHHAFFDPRAFHDALLLVPKSEEVGWPMDFVGSRIGLNMGGRTYFSSSEDDFVSRLYRRSRPVEPGSTILSNSPRCQAEGCNADLSQAKHYHHRHKVCEFHSKAATVIAAGLTQRLCQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo