SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma16g19457

Feature Type:gene_model
Chromosome:Gm16
Start:21369780
stop:21371723
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma16g19457
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G36010AT Annotation by Michelle Graham. TAIR10: E2F transcription factor 3 | chr2:15119688-15122893 FORWARD LENGTH=514 SoyBaseE_val: 8.00E-25ISS
GO:0006270GO-bp Annotation by Michelle Graham. GO Biological Process: DNA replication initiation SoyBaseN/AISS
GO:0006275GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of DNA replication SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0008283GO-bp Annotation by Michelle Graham. GO Biological Process: cell proliferation SoyBaseN/AISS
GO:0009165GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide biosynthetic process SoyBaseN/AISS
GO:0010090GO-bp Annotation by Michelle Graham. GO Biological Process: trichome morphogenesis SoyBaseN/AISS
GO:0042023GO-bp Annotation by Michelle Graham. GO Biological Process: DNA endoreduplication SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0051302GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell division SoyBaseN/AISS
GO:0051446GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of meiotic cell cycle SoyBaseN/AISS
GO:0051726GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005667GO-cc Annotation by Michelle Graham. GO Cellular Compartment: transcription factor complex SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PTHR12081Panther E2F JGI ISS
PTHR12081:SF18Panther E2F4,5 JGI ISS
UniRef100_G7J4Q9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor E2F5 n=1 Tax=Medicago truncatula RepID=G7J4Q9_MEDTR SoyBaseE_val: 8.00E-47ISS
UniRef100_UPI000233EBE8UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233EBE8 related cluster n=1 Tax=unknown RepID=UPI000233EBE8 SoyBaseE_val: 6.00E-99ISS

Expression Patterns of Glyma16g19457
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g19457 not represented in the dataset
Glyma16g19457 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma16g19457 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.16g097500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma16g19457
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma16g19457
>Glyma16g19457.1   sequence type=CDS   gene model=Glyma16g19457   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTCGCTCGGACCACCCGGAAATCCCTGAGGCTGATCCTCAGCCGCCTCTGCGCCTACGTCTGCAGGAATGTCCTCAACAGCAGCTGGTGCCTCCATCGGCTTGCTTGATCATTAGGTACCTTTTTTTAATCAAGGAAGATATTCTTAGCCTTCCCTGCTTCCAGAATCAAGAAATTATTGCAATCAAGGCTCCAAAAGCTAGTTGCATCGAGGTCCCTGATCCTGATGAGGAATTAGGTTTTCGGCAAAGGCAGTACAAAATGATTGTTCGAAGTGCCATTGGACCAATAAATTTGTATCTCTTGAGCAAGGACGACCGCAAGTTTGAGGATGATAGTGCCAACCGGATGAAATTAATGGATCCATCATGGAATAGTGATTCCATCAGAAAGAGGGGTGTGGGATTATTAGAAAGCCAACATGATGAAAAAAAAAATCCTTCTGAGCGTTTCAGTTTGCAGGGTTCACAAGCATTTGGAATTCAAGAAATTACTCCCACGGATTTTGAAATGGAAGATGACTATTGGTTTCAATCAGATCCTGGAGTGAGCCAAATAGAATTGTAG
Predicted protein sequences of Glyma16g19457
>Glyma16g19457.1   sequence type=predicted peptide   gene model=Glyma16g19457   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGRSDHPEIPEADPQPPLRLRLQECPQQQLVPPSACLIIRYLFLIKEDILSLPCFQNQEIIAIKAPKASCIEVPDPDEELGFRQRQYKMIVRSAIGPINLYLLSKDDRKFEDDSANRMKLMDPSWNSDSIRKRGVGLLESQHDEKKNPSERFSLQGSQAFGIQEITPTDFEMEDDYWFQSDPGVSQIEL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo