SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma16g19405

Feature Type:gene_model
Chromosome:Gm16
Start:21327476
stop:21328003
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma16g19405
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G40170AT Annotation by Michelle Graham. TAIR10: Stress induced protein | chr2:16779792-16780167 REVERSE LENGTH=92 SoyBaseE_val: 2.00E-21ISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009845GO-bp Annotation by Michelle Graham. GO Biological Process: seed germination SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0009933GO-bp Annotation by Michelle Graham. GO Biological Process: meristem structural organization SoyBaseN/AISS
GO:0010162GO-bp Annotation by Michelle Graham. GO Biological Process: seed dormancy process SoyBaseN/AISS
GO:0010182GO-bp Annotation by Michelle Graham. GO Biological Process: sugar mediated signaling pathway SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0016114GO-bp Annotation by Michelle Graham. GO Biological Process: terpenoid biosynthetic process SoyBaseN/AISS
GO:0016567GO-bp Annotation by Michelle Graham. GO Biological Process: protein ubiquitination SoyBaseN/AISS
GO:0019915GO-bp Annotation by Michelle Graham. GO Biological Process: lipid storage SoyBaseN/AISS
GO:0048316GO-bp Annotation by Michelle Graham. GO Biological Process: seed development SoyBaseN/AISS
GO:0048700GO-bp Annotation by Michelle Graham. GO Biological Process: acquisition of desiccation tolerance in seed SoyBaseN/AISS
GO:0050826GO-bp Annotation by Michelle Graham. GO Biological Process: response to freezing SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF00477PFAM Small hydrophilic plant seed protein JGI ISS
UniRef100_Q2Q4Y5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Em6 n=1 Tax=Medicago truncatula RepID=Q2Q4Y5_MEDTR SoyBaseE_val: 2.00E-22ISS
UniRef100_UPI000233B4ADUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233B4AD related cluster n=1 Tax=unknown RepID=UPI000233B4AD SoyBaseE_val: 7.00E-33ISS

Expression Patterns of Glyma16g19405
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g19405 not represented in the dataset
Glyma16g19405 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma16g19405
ParalogEvidenceComments
Glyma18g43320 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma16g19405 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.16g097900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma16g19405
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma16g19405
>Glyma16g19405.1   sequence type=CDS   gene model=Glyma16g19405   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAATCTCAGCAAGCAAACCGTGAAGAACTTCATGAGAGGGCAAGGAACCGTGGAGGGCAGACGAGGAAGGAGCAGATGGGGAGAGAAGGGTACCAAGAGATGGGACGCAAAGGAGGCCTCAGCACCATGGACAAGTCTGGTGTAGAGCGTGCTGAAGAGGAAGGCATAGACATCGATGAGTCTAAGTTTAAGAATAAATAA
Predicted protein sequences of Glyma16g19405
>Glyma16g19405.1   sequence type=predicted peptide   gene model=Glyma16g19405   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MESQQANREELHERARNRGGQTRKEQMGREGYQEMGRKGGLSTMDKSGVERAEEEGIDIDESKFKNK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo