SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma16g19340): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma16g19340): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma16g19340

Feature Type:gene_model
Chromosome:Gm16
Start:21308120
stop:21309136
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G51820AT Annotation by Michelle Graham. TAIR10: UbiA prenyltransferase family protein | chr3:19216301-19218934 REVERSE LENGTH=387 SoyBaseE_val: 2.00E-86ISS
GO:0006098GO-bp Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt SoyBaseN/AISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0009073GO-bp Annotation by Michelle Graham. GO Biological Process: aromatic amino acid family biosynthetic process SoyBaseN/AISS
GO:0009902GO-bp Annotation by Michelle Graham. GO Biological Process: chloroplast relocation SoyBaseN/AISS
GO:0009965GO-bp Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis SoyBaseN/AISS
GO:0010027GO-bp Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization SoyBaseN/AISS
GO:0015995GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process SoyBaseN/AISS
GO:0016117GO-bp Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0030154GO-bp Annotation by Michelle Graham. GO Biological Process: cell differentiation SoyBaseN/AISS
GO:0034660GO-bp Annotation by Michelle Graham. GO Biological Process: ncRNA metabolic process SoyBaseN/AISS
GO:0042793GO-bp Annotation by Michelle Graham. GO Biological Process: transcription from plastid promoter SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0004659GO-mf Annotation by Michelle Graham. GO Molecular Function: prenyltransferase activity SoyBaseN/AISS
GO:0046408GO-mf Annotation by Michelle Graham. GO Molecular Function: chlorophyll synthetase activity SoyBaseN/AISS
PTHR11048Panther PRENYLTRANSFERASES JGI ISS
PTHR11048:SF12Panther SUBFAMILY NOT NAMED JGI ISS
PF01040PFAM UbiA prenyltransferase family JGI ISS
UniRef100_B9SWY8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Bacteriochlorophyll synthase, putative n=1 Tax=Ricinus communis RepID=B9SWY8_RICCO SoyBaseE_val: 2.00E-89ISS
UniRef100_I1MMP6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1MMP6_SOYBN SoyBaseE_val: 1.00E-105ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma16g19340 not represented in the dataset

Glyma16g19340 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma07g18470 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Glyma18g43310 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.16g098300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma16g19340.1   sequence type=CDS   gene model=Glyma16g19340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AATAAATGGAAGATTCGTCTTCAACTCACAAAGCCTGTCACTTGGCCTCCGTTAGTTTGGGGAGTAGTTTGTGGTGCTGCTGCCTCGGGAAATTTTCATTGGAATTTTGAGGATGTTGCTAAATCAATTGTGTGCATGATGATGTCCGGCCCATTCCTGACAGGATATACACAGACTCTGAATGATTGGTATGACCGAGAAATTGACGCAATAAATGAACCTTATAGATCAATTCCTTCTGGGGCAATATCTGAGAATGAGGTAATCACTCAAATATGGGTGTTGCTGCTTGGTGGTCTTTCTCTGGCTGGTATATTGGACATATGGGCAGGGCATGATTTCCCTATAGTATTTTACCTTGCAGTGGGTGGAGCCATACTGTCTTATATATATTCTGCGCCTCCTTTAAAGTTAAAACAAAATGGATGGATTGGAAACTTTGCCCTTGGAGCA

>Glyma16g19340.1   sequence type=predicted peptide   gene model=Glyma16g19340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
NKWKIRLQLTKPVTWPPLVWGVVCGAAASGNFHWNFEDVAKSIVCMMMSGPFLTGYTQTLNDWYDREIDAINEPYRSIPSGAISENEVITQIWVLLLGGLSLAGILDIWAGHDFPIVFYLAVGGAILSYIYSAPPLKLKQNGWIGNFALGA







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo